Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4707
Gene name
Locationscaffold_376:12460..14475
Strand-
Gene length (bp)2015
Transcript length (bp)1761
Coding sequence length (bp)1758
Protein length (aa) 586

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 2.1E-24 132 427
PF04083 Abhydro_lipase Partial alpha/beta-hydrolase lipase region 6.9E-21 81 148

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P78898|TGCE2_SCHPO Probable lipase C16A3.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.12c PE=3 SV=2 7 443 1.0E-136
sp|O74430|TGCE1_SCHPO Probable lipase C1672.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1672.09 PE=1 SV=1 3 443 6.0E-135
sp|O60095|TGCE3_SCHPO Probable lipase C14C8.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC14C8.15 PE=3 SV=1 17 444 1.0E-121
sp|P34163|TGL1_YEAST Sterol esterase TGL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TGL1 PE=1 SV=1 1 572 2.0E-118
sp|P07098|LIPG_HUMAN Gastric triacylglycerol lipase OS=Homo sapiens GN=LIPF PE=1 SV=1 83 439 1.0E-54
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P78898|TGCE2_SCHPO Probable lipase C16A3.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.12c PE=3 SV=2 7 443 1.0E-136
sp|O74430|TGCE1_SCHPO Probable lipase C1672.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1672.09 PE=1 SV=1 3 443 6.0E-135
sp|O60095|TGCE3_SCHPO Probable lipase C14C8.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC14C8.15 PE=3 SV=1 17 444 1.0E-121
sp|P34163|TGL1_YEAST Sterol esterase TGL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TGL1 PE=1 SV=1 1 572 2.0E-118
sp|P07098|LIPG_HUMAN Gastric triacylglycerol lipase OS=Homo sapiens GN=LIPF PE=1 SV=1 83 439 1.0E-54
sp|P80035|LIPG_CANLF Gastric triacylglycerol lipase OS=Canis lupus familiaris GN=LIPF PE=1 SV=2 83 439 2.0E-54
sp|Q9Z0M5|LICH_MOUSE Lysosomal acid lipase/cholesteryl ester hydrolase OS=Mus musculus GN=Lipa PE=1 SV=2 80 446 1.0E-53
sp|P04634|LIPG_RAT Gastric triacylglycerol lipase OS=Rattus norvegicus GN=Lipf PE=1 SV=1 83 443 4.0E-53
sp|Q8BM14|LIPK_MOUSE Lipase member K OS=Mus musculus GN=Lipk PE=2 SV=1 67 436 2.0E-52
sp|Q9CPP7|LIPG_MOUSE Gastric triacylglycerol lipase OS=Mus musculus GN=Lipf PE=2 SV=1 83 439 7.0E-52
sp|Q5VXJ0|LIPK_HUMAN Lipase member K OS=Homo sapiens GN=LIPK PE=2 SV=2 83 446 9.0E-52
sp|Q64194|LICH_RAT Lysosomal acid lipase/cholesteryl ester hydrolase OS=Rattus norvegicus GN=Lipa PE=2 SV=1 80 446 8.0E-50
sp|Q5W064|LIPJ_HUMAN Lipase member J OS=Homo sapiens GN=LIPJ PE=2 SV=3 83 443 3.0E-47
sp|J3SDX8|LICH_CROAD Putative lysosomal acid lipase/cholesteryl ester hydrolase OS=Crotalus adamanteus PE=2 SV=1 78 443 5.0E-47
sp|Q29458|LIPG_BOVIN Gastric triacylglycerol lipase OS=Bos taurus GN=LIPF PE=1 SV=1 62 439 3.0E-46
sp|Q4R4S5|LICH_MACFA Lysosomal acid lipase/cholesteryl ester hydrolase OS=Macaca fascicularis GN=LIPA PE=2 SV=1 83 446 3.0E-46
sp|P38571|LICH_HUMAN Lysosomal acid lipase/cholesteryl ester hydrolase OS=Homo sapiens GN=LIPA PE=1 SV=2 83 446 4.0E-46
sp|Q8K2A6|LIPM_MOUSE Lipase member M OS=Mus musculus GN=Lipm PE=2 SV=1 71 440 7.0E-43
sp|Q5VYY2|LIPM_HUMAN Lipase member M OS=Homo sapiens GN=LIPM PE=2 SV=2 73 440 6.0E-41
sp|Q3YBN2|TALLP_MESAU Tear acid lipase-like protein OS=Mesocricetus auratus PE=1 SV=1 88 425 1.0E-40
sp|Q3U4B4|LIPN_MOUSE Lipase member N OS=Mus musculus GN=Lipn PE=2 SV=1 89 446 3.0E-37
sp|O46108|LIP3_DROME Lipase 3 OS=Drosophila melanogaster GN=Lip3 PE=2 SV=1 76 446 1.0E-34
sp|Q5VXI9|LIPN_HUMAN Lipase member N OS=Homo sapiens GN=LIPN PE=2 SV=2 89 447 7.0E-33
sp|O46107|LIP1_DROME Lipase 1 OS=Drosophila melanogaster GN=Lip1 PE=2 SV=2 83 464 1.0E-30
sp|Q71DJ5|LIP1_ARATH Triacylglycerol lipase 1 OS=Arabidopsis thaliana GN=LIP1 PE=1 SV=1 90 439 1.0E-28
sp|Q67ZU1|LIP2_ARATH Triacylglycerol lipase 2 OS=Arabidopsis thaliana GN=LIP2 PE=2 SV=1 87 439 9.0E-26
sp|Q07950|YEH2_YEAST Sterol esterase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEH2 PE=1 SV=1 64 443 2.0E-22
sp|Q07804|YEH1_YEAST Sterol esterase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEH1 PE=1 SV=1 91 446 2.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4707
MPLPFLGRLHPAEYLAIIGSFILVGLEAVIRVCTLSLPAFLVSLFYRASRLIFNRYTSPAQKRAENKQKSVSTSV
RDASDFVELCRIWGHEAEEHIVQTKDGYLLGIHRLQWKKGEEGQNVNCGHESLRKRVVYLHHGLLMNSEVWVCLT
DEQRCLPFQLLDRGFDVWLGNNRGNKYSKKSIHTSPTSVNFWDFSMDEFAFHDIPDTISYILETTQQESLSYIGF
SQGTAQAFATLAIHPRLNNQVNVFIALAPAMAPAGLSNGMVDALVKASPSVLYLMFGRRSILSSATMWETLVYPP
LFCRLIDMGLSFLFGWRTKNLSTSQKLAAYPHLYSFTSTKSVVHWFQIIRNRCFQMYDDDLQKLVSVSSSQKYSK
VAKYPTRNIRTPVVLLYGGSDSLVDIRSMLKELPPQTVATEIPHYEHLDFLWARDVDSQVFQHVFDALDSFTDAG
HTREEYDRYKLVRSESLIGSGYSLAHHRHHRGGSESESSTMAGSNDGGGSSSPRLVLQHHAREGQLQDSSAQPHQ
RRSHPAGRPKKTEDDAESTPSADKLKGVGRRRSCGANSTTALDSINETKGYSAGVEPVHQR
Coding >Ophio5|4707
ATGCCACTTCCCTTTCTCGGGAGGTTACACCCCGCCGAGTATCTTGCCATCATTGGATCCTTCATCCTCGTCGGC
CTCGAGGCTGTCATACGCGTCTGCACTCTTTCGCTGCCCGCGTTTCTTGTCTCGCTCTTCTATCGAGCCTCGCGC
CTCATCTTTAACCGCTACACGTCTCCCGCACAGAAGCGCGCAGAGAACAAGCAAAAATCCGTGTCTACCTCCGTC
CGCGATGCCTCCGACTTCGTTGAGCTGTGTCGCATCTGGGGACACGAGGCTGAAGAGCACATCGTCCAGACAAAG
GATGGCTATCTCCTCGGCATCCATCGTCTGCAGTGGAAAAAGGGCGAGGAAGGGCAGAATGTCAATTGCGGACAT
GAAAGCCTTCGGAAACGGGTCGTGTATCTGCATCACGGCTTGCTGATGAACTCGGAGGTCTGGGTTTGCCTCACC
GACGAGCAGAGGTGTCTGCCCTTTCAGCTGCTTGACCGCGGATTCGACGTCTGGCTTGGAAACAATCGCGGAAAC
AAATACTCTAAAAAGTCGATCCACACGTCTCCCACCTCGGTCAACTTCTGGGACTTTTCCATGGATGAATTCGCC
TTCCACGATATCCCAGACACCATCAGCTACATTCTCGAAACTACACAGCAGGAGAGCCTGTCCTACATCGGCTTC
TCCCAGGGCACAGCCCAGGCCTTTGCCACGCTGGCCATCCACCCTCGTCTCAACAACCAGGTCAACGTCTTCATC
GCCCTGGCGCCCGCCATGGCGCCCGCCGGCCTGTCCAACGGCATGGTCGACGCCCTGGTCAAGGCCTCTCCGTCG
GTGCTGTACCTGATGTTCGGCAGACGGTCCATCCTGAGCTCGGCCACCATGTGGGAAACGCTCGTCTACCCGCCG
CTCTTCTGCCGTCTCATCGACATGGGCCTTTCCTTTCTCTTCGGCTGGCGCACAAAGAACCTGTCGACGAGTCAG
AAGCTGGCGGCCTATCCTCACCTGTACTCCTTCACCAGCACCAAGAGCGTGGTGCACTGGTTCCAAATCATCCGC
AACCGCTGCTTTCAAATGTACGACGACGACTTGCAGAAGCTGGTCAGCGTAAGCTCGTCGCAGAAATACTCCAAA
GTGGCCAAATATCCGACGCGCAACATAAGAACGCCCGTGGTGCTCCTCTACGGCGGAAGCGACTCCCTCGTCGAT
ATCCGCTCCATGCTCAAGGAGCTACCGCCTCAGACGGTGGCGACGGAGATTCCGCACTACGAGCACCTCGACTTT
CTCTGGGCTAGGGACGTGGATTCTCAGGTGTTTCAGCACGTCTTCGACGCTCTCGACAGCTTCACCGATGCCGGC
CACACTAGAGAGGAGTACGATCGGTATAAGCTGGTCAGGAGCGAAAGCCTCATCGGCTCCGGCTACTCCCTCGCT
CACCACCGTCATCACCGCGGCGGTAGCGAAAGCGAAAGTTCCACCATGGCCGGCAGCAACGACGGTGGCGGTAGC
TCCTCTCCCCGTCTTGTACTCCAACACCACGCCCGCGAGGGACAACTCCAGGATAGTAGTGCCCAGCCTCATCAA
CGACGCTCTCACCCCGCTGGCCGACCCAAGAAGACAGAGGACGATGCGGAATCGACGCCGTCGGCAGATAAGCTC
AAGGGAGTCGGCCGTCGGCGCAGCTGCGGAGCCAATAGCACCACCGCCCTGGACAGCATCAACGAAACCAAGGGC
TACAGTGCCGGCGTCGAACCCGTCCATCAAAGG
Transcript >Ophio5|4707
ATGCCACTTCCCTTTCTCGGGAGGTTACACCCCGCCGAGTATCTTGCCATCATTGGATCCTTCATCCTCGTCGGC
CTCGAGGCTGTCATACGCGTCTGCACTCTTTCGCTGCCCGCGTTTCTTGTCTCGCTCTTCTATCGAGCCTCGCGC
CTCATCTTTAACCGCTACACGTCTCCCGCACAGAAGCGCGCAGAGAACAAGCAAAAATCCGTGTCTACCTCCGTC
CGCGATGCCTCCGACTTCGTTGAGCTGTGTCGCATCTGGGGACACGAGGCTGAAGAGCACATCGTCCAGACAAAG
GATGGCTATCTCCTCGGCATCCATCGTCTGCAGTGGAAAAAGGGCGAGGAAGGGCAGAATGTCAATTGCGGACAT
GAAAGCCTTCGGAAACGGGTCGTGTATCTGCATCACGGCTTGCTGATGAACTCGGAGGTCTGGGTTTGCCTCACC
GACGAGCAGAGGTGTCTGCCCTTTCAGCTGCTTGACCGCGGATTCGACGTCTGGCTTGGAAACAATCGCGGAAAC
AAATACTCTAAAAAGTCGATCCACACGTCTCCCACCTCGGTCAACTTCTGGGACTTTTCCATGGATGAATTCGCC
TTCCACGATATCCCAGACACCATCAGCTACATTCTCGAAACTACACAGCAGGAGAGCCTGTCCTACATCGGCTTC
TCCCAGGGCACAGCCCAGGCCTTTGCCACGCTGGCCATCCACCCTCGTCTCAACAACCAGGTCAACGTCTTCATC
GCCCTGGCGCCCGCCATGGCGCCCGCCGGCCTGTCCAACGGCATGGTCGACGCCCTGGTCAAGGCCTCTCCGTCG
GTGCTGTACCTGATGTTCGGCAGACGGTCCATCCTGAGCTCGGCCACCATGTGGGAAACGCTCGTCTACCCGCCG
CTCTTCTGCCGTCTCATCGACATGGGCCTTTCCTTTCTCTTCGGCTGGCGCACAAAGAACCTGTCGACGAGTCAG
AAGCTGGCGGCCTATCCTCACCTGTACTCCTTCACCAGCACCAAGAGCGTGGTGCACTGGTTCCAAATCATCCGC
AACCGCTGCTTTCAAATGTACGACGACGACTTGCAGAAGCTGGTCAGCGTAAGCTCGTCGCAGAAATACTCCAAA
GTGGCCAAATATCCGACGCGCAACATAAGAACGCCCGTGGTGCTCCTCTACGGCGGAAGCGACTCCCTCGTCGAT
ATCCGCTCCATGCTCAAGGAGCTACCGCCTCAGACGGTGGCGACGGAGATTCCGCACTACGAGCACCTCGACTTT
CTCTGGGCTAGGGACGTGGATTCTCAGGTGTTTCAGCACGTCTTCGACGCTCTCGACAGCTTCACCGATGCCGGC
CACACTAGAGAGGAGTACGATCGGTATAAGCTGGTCAGGAGCGAAAGCCTCATCGGCTCCGGCTACTCCCTCGCT
CACCACCGTCATCACCGCGGCGGTAGCGAAAGCGAAAGTTCCACCATGGCCGGCAGCAACGACGGTGGCGGTAGC
TCCTCTCCCCGTCTTGTACTCCAACACCACGCCCGCGAGGGACAACTCCAGGATAGTAGTGCCCAGCCTCATCAA
CGACGCTCTCACCCCGCTGGCCGACCCAAGAAGACAGAGGACGATGCGGAATCGACGCCGTCGGCAGATAAGCTC
AAGGGAGTCGGCCGTCGGCGCAGCTGCGGAGCCAATAGCACCACCGCCCTGGACAGCATCAACGAAACCAAGGGC
TACAGTGCCGGCGTCGAACCCGTCCATCAAAGGTAA
Gene >Ophio5|4707
ATGCCACTTCCCTTTCTCGGGAGGTTACACCCGTTCGTACAATCTCCCCAACCCTGCCCAACCGACTACCGACTG
ACGCTCGGACGCAAGCGCCGAGTATCTTGCCATCATTGGATCCTTCATCCTCGTCGGCCTCGAGGCTGTCATACG
CGTCTGCACTCTTTCGCTGCGTATGTAACTTACTCACCTCGATTTTTTTTTTTTTTTTTTTGCGCCACAGACTCT
AACTTTTTCTTGCCGAAAGCCGCGTTTCTTGTCTCGCTCTTCTATCGAGCCTCGCGCCTCATCTTTAACCGCTAC
ACGTCTCCCGCACAGAAGCGCGCAGAGAACAAGCAAAAATGTCCTCCACTACTTCCTCCCCTCTGTCGTCTACGT
TCGTAACTGACCTTTTCTTTTCCCCCTTGAAGCCGTGTCTACCTCCGTCCGCGATGCCTCCGACTTCGTTGAGCT
GTGTCGCATCTGGGGACACGAGGCTGAAGAGCACATCGTCCAGACAAAGGATGGCTATCTCCTCGGCATCCATCG
TCTGCAGTGGAAAAAGGGCGAGGAAGGGCAGAATGTCAATTGCGGACATGAAAGCCTTCGGAAACGGGTCGTGTA
TCTGCATCACGGCTTGCTGATGAACTCGGAGGTCTGGGTTTGCCTCACCGACGAGCAGAGGTGTCTGCCCTTTCA
GCTGCTTGACCGCGGATTCGACGTCTGGGTATGTCCACCTTGTTTTTGTTATTGTTGTTGCCATGCTTTGCTGAC
TCGCGCAGCTTGGAAACAATCGCGGAAACAAATACTCTAAAAAGTCGATCCACACGTCTCCCACCTCGGTCAACT
TCTGGGACTTTTCCATGGATGAATTCGCCTTCCACGATATCCCAGACACCATCAGCTACATTCTCGAAACTACAC
AGCAGGAGAGCCTGTCCTACATCGGCTTCTCCCAGGGCACAGCCCAGGCCTTTGCCACGCTGGCCATCCACCCTC
GTCTCAACAACCAGGTCAACGTCTTCATCGCCCTGGCGCCCGCCATGGCGCCCGCCGGCCTGTCCAACGGCATGG
TCGACGCCCTGGTCAAGGCCTCTCCGTCGGTGCTGTACCTGATGTTCGGCAGACGGTCCATCCTGAGCTCGGCCA
CCATGTGGGAAACGCTCGTCTACCCGCCGCTCTTCTGCCGTCTCATCGACATGGGCCTTTCCTTTCTCTTCGGCT
GGCGCACAAAGAACCTGTCGACGAGTCAGAAGCTGGCGGCCTATCCTCACCTGTACTCCTTCACCAGCACCAAGA
GCGTGGTGCACTGGTTCCAAATCATCCGCAACCGCTGCTTTCAAATGTACGACGACGACTTGCAGAAGCTGGTCA
GCGTAAGCTCGTCGCAGAAATACTCCAAAGTGGCCAAATATCCGACGCGCAACATAAGAACGCCCGTGGTGCTCC
TCTACGGCGGAAGCGACTCCCTCGTCGATATCCGCTCCATGCTCAAGGAGCTACCGCCTCAGACGGTGGCGACGG
AGATTCCGCACTACGAGCACCTCGACTTTCTCTGGGCTAGGGACGTGGATTCTCAGGTGTTTCAGCACGTCTTCG
ACGCTCTCGACAGCTTCACCGATGCCGGCCACACTAGAGAGGAGTACGATCGGTATAAGCTGGTCAGGAGCGAAA
GCCTCATCGGCTCCGGCTACTCCCTCGCTCACCACCGTCATCACCGCGGCGGTAGCGAAAGCGAAAGTTCCACCA
TGGCCGGCAGCAACGACGGTGGCGGTAGCTCCTCTCCCCGTCTTGTACTCCAACACCACGCCCGCGAGGGACAAC
TCCAGGATAGTAGTGCCCAGCCTCATCAACGACGCTCTCACCCCGCTGGCCGACCCAAGAAGACAGAGGACGATG
CGGAATCGACGCCGTCGGCAGATAAGCTCAAGGGAGTCGGCCGTCGGCGCAGCTGCGGAGCCAATAGCACCACCG
CCCTGGACAGCATCAACGAAACCAAGGGCTACAGTGCCGGCGTCGAACCCGTCCATCAAAGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail