Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4693
Gene name
Locationscaffold_374:6681..7754
Strand-
Gene length (bp)1073
Transcript length (bp)966
Coding sequence length (bp)963
Protein length (aa) 321

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05739 SNARE SNARE domain 1.2E-13 265 317
PF11416 Syntaxin-5_N Syntaxin-5 N-terminal, Sly1p-binding domain 7.7E-10 2 23

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13644|SED5_SCHPO Integral membrane protein sed5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sed5 PE=3 SV=1 5 320 1.0E-86
sp|Q01590|SED5_YEAST Integral membrane protein SED5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SED5 PE=1 SV=1 5 320 9.0E-59
sp|Q08DB5|STX5_BOVIN Syntaxin-5 OS=Bos taurus GN=STX5 PE=2 SV=1 5 304 2.0E-57
sp|Q8K1E0|STX5_MOUSE Syntaxin-5 OS=Mus musculus GN=Stx5 PE=1 SV=3 5 304 3.0E-57
sp|Q13190|STX5_HUMAN Syntaxin-5 OS=Homo sapiens GN=STX5 PE=1 SV=2 5 304 7.0E-57
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13644|SED5_SCHPO Integral membrane protein sed5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sed5 PE=3 SV=1 5 320 1.0E-86
sp|Q01590|SED5_YEAST Integral membrane protein SED5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SED5 PE=1 SV=1 5 320 9.0E-59
sp|Q08DB5|STX5_BOVIN Syntaxin-5 OS=Bos taurus GN=STX5 PE=2 SV=1 5 304 2.0E-57
sp|Q8K1E0|STX5_MOUSE Syntaxin-5 OS=Mus musculus GN=Stx5 PE=1 SV=3 5 304 3.0E-57
sp|Q13190|STX5_HUMAN Syntaxin-5 OS=Homo sapiens GN=STX5 PE=1 SV=2 5 304 7.0E-57
sp|Q08851|STX5_RAT Syntaxin-5 OS=Rattus norvegicus GN=Stx5 PE=1 SV=2 5 304 1.0E-56
sp|Q24509|STX5_DROME Syntaxin-5 OS=Drosophila melanogaster GN=Syx5 PE=2 SV=2 1 305 4.0E-55
sp|Q9LK09|SYP32_ARATH Syntaxin-32 OS=Arabidopsis thaliana GN=SYP32 PE=2 SV=1 55 318 3.0E-48
sp|Q9FFK1|SYP31_ARATH Syntaxin-31 OS=Arabidopsis thaliana GN=SYP31 PE=1 SV=1 3 318 1.0E-43
sp|Q20797|STX5_CAEEL Putative syntaxin-5 OS=Caenorhabditis elegans GN=syx-5 PE=3 SV=1 7 304 4.0E-41
sp|O14662|STX16_HUMAN Syntaxin-16 OS=Homo sapiens GN=STX16 PE=1 SV=3 64 301 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

Domain # Start End Length
1 300 319 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 34.23 16.10 52.36
CcL In ants, during behavior modification 41.27 19.73 62.81
CcD In ants, recently dead 32.73 15.27 50.18

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.512063 no
SC16a CcD 0.893724 no
CcL CcD 0.397403 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4693
MAAASIQDRTAEFKSVLAQAQRRQPSNKVGSQRRSLLSDSQKAAAADGDAKTPRRSDFARKAAEIGRGISATMGK
LEKLALLAKRRTLFDDRPVEINELTFVIKQDLSSLNQQIGALQTLSKQQHSKADQEGEHNKNVVYLLQGKLTDVS
VNFKDVLEARTKNIQASRSRTENFISSVSQHAQPPLQPSASPLYGTPNRASPAPGSDTLSLNPVGDQQLLMMEEA
QPTNTYTQQRGEAIEAIEKTISELGSIFGQLATMVSEQSDMIQRIDANTEDVVDNVEGAQRELLKYWTRVSSNRW
LIAKMFGVLMIFFLLWVLVSG
Coding >Ophio5|4693
ATGGCCGCCGCATCCATCCAAGACCGAACGGCCGAGTTCAAGTCGGTCCTGGCGCAGGCTCAGCGTCGCCAGCCA
TCCAACAAGGTCGGTTCACAGCGGAGATCGCTGCTGAGTGACTCGCAAAAGGCCGCGGCCGCGGATGGAGACGCA
AAGACACCCCGGCGCTCCGACTTTGCCCGGAAGGCGGCTGAGATCGGTCGCGGCATCTCGGCCACCATGGGCAAG
CTGGAGAAGCTAGCGCTGCTCGCTAAGCGCCGCACGCTCTTCGACGACCGGCCCGTCGAAATCAACGAGCTCACC
TTCGTCATCAAGCAAGACCTCTCGTCGCTGAACCAGCAGATTGGCGCGCTTCAGACGCTCTCCAAGCAGCAGCAC
TCCAAGGCCGACCAGGAGGGCGAGCACAACAAGAACGTCGTCTACCTGCTGCAGGGAAAGCTTACCGACGTCTCG
GTCAACTTCAAGGACGTGCTCGAGGCCCGGACGAAGAATATCCAGGCCTCACGGTCACGGACGGAAAACTTTATA
TCGTCGGTGTCGCAGCACGCCCAGCCGCCGCTGCAGCCGTCGGCCTCGCCCCTGTACGGCACGCCCAACCGCGCC
TCACCCGCGCCGGGCTCCGACACGCTGTCGCTCAACCCCGTCGGCGACCAGCAGCTACTGATGATGGAGGAGGCC
CAGCCGACAAACACGTACACACAGCAGAGGGGCGAGGCCATCGAGGCCATCGAAAAGACCATCAGCGAGCTGGGC
AGCATCTTTGGCCAGCTGGCCACCATGGTCTCGGAGCAGAGCGACATGATCCAGCGCATCGACGCCAATACGGAA
GACGTGGTCGACAACGTCGAGGGCGCCCAGCGCGAGCTGCTCAAGTACTGGACGCGCGTGTCGAGCAACCGGTGG
CTTATTGCCAAGATGTTTGGCGTCTTGATGATATTCTTTTTACTCTGGGTTCTCGTGTCGGGT
Transcript >Ophio5|4693
ATGGCCGCCGCATCCATCCAAGACCGAACGGCCGAGTTCAAGTCGGTCCTGGCGCAGGCTCAGCGTCGCCAGCCA
TCCAACAAGGTCGGTTCACAGCGGAGATCGCTGCTGAGTGACTCGCAAAAGGCCGCGGCCGCGGATGGAGACGCA
AAGACACCCCGGCGCTCCGACTTTGCCCGGAAGGCGGCTGAGATCGGTCGCGGCATCTCGGCCACCATGGGCAAG
CTGGAGAAGCTAGCGCTGCTCGCTAAGCGCCGCACGCTCTTCGACGACCGGCCCGTCGAAATCAACGAGCTCACC
TTCGTCATCAAGCAAGACCTCTCGTCGCTGAACCAGCAGATTGGCGCGCTTCAGACGCTCTCCAAGCAGCAGCAC
TCCAAGGCCGACCAGGAGGGCGAGCACAACAAGAACGTCGTCTACCTGCTGCAGGGAAAGCTTACCGACGTCTCG
GTCAACTTCAAGGACGTGCTCGAGGCCCGGACGAAGAATATCCAGGCCTCACGGTCACGGACGGAAAACTTTATA
TCGTCGGTGTCGCAGCACGCCCAGCCGCCGCTGCAGCCGTCGGCCTCGCCCCTGTACGGCACGCCCAACCGCGCC
TCACCCGCGCCGGGCTCCGACACGCTGTCGCTCAACCCCGTCGGCGACCAGCAGCTACTGATGATGGAGGAGGCC
CAGCCGACAAACACGTACACACAGCAGAGGGGCGAGGCCATCGAGGCCATCGAAAAGACCATCAGCGAGCTGGGC
AGCATCTTTGGCCAGCTGGCCACCATGGTCTCGGAGCAGAGCGACATGATCCAGCGCATCGACGCCAATACGGAA
GACGTGGTCGACAACGTCGAGGGCGCCCAGCGCGAGCTGCTCAAGTACTGGACGCGCGTGTCGAGCAACCGGTGG
CTTATTGCCAAGATGTTTGGCGTCTTGATGATATTCTTTTTACTCTGGGTTCTCGTGTCGGGTTAG
Gene >Ophio5|4693
ATGGCCGCCGCATCCATCCAAGACCGAACGGCCGAGTTCAAGTCGGTCCTGGCGCAGGCTCAGCGTCGCCAGCCA
TCCAACAAGGTCGGTTCACAGCGGAGATCGCTGCTGAGTGACTCGCAAAAGGCCGCGGCCGCGGATGGAGACGCA
AAGACACCCCGGCGCTCCGACTTTGCCCGGAAGGCGGCTGAGATCGGTCGCGGCATCTCGGCCACCATGGGCAAG
CTGGAGAAGCTAGCGCTGCGTGAGTTGGCCGAGCGAGACGAGAGATACAGCGCATTCTGATTATATTGCAGTCGC
TAAGCGCCGCACGCTCTTCGACGACCGGCCCGTCGAAATCAACGAGCTCACCTTCGTCATCAAGCAAGACCTCTC
GTCGCTGAACCAGCAGATTGGCGCGCTTCAGACGCTCTCCAAGCAGCAGCACTCCAAGGCCGACCAGGAGGGCGA
GCACAACAAGAACGTCGTCTACCTGCTGCAGGGAAAGCTTACCGACGTCTCGGTCAACTTCAAGGACGTGCTCGA
GGCCCGGACGAAGAATATCCAGGCCTCACGGTCACGGACGGAAAACTTTATATCGTCGGTGTCGCAGCACGCCCA
GCCGCCGCTGCAGCCGTCGGCCTCGCCCCTGTACGGCACGCCCAACCGCGCCTCACCCGCGCCGGGCTCCGACAC
GCTGTCGCTCAACCCCGTCGGCGACCAGCAGCTACTGATGATGGAGGAGGCCCAGCCGACAAACACGTACACACA
GCAGAGGGGCGAGGCCATCGAGGCCATCGAAAAGACCATCAGCGAGCTGGGCAGCATCTTTGGCCAGCTGGCCAC
CATGGTCTCGGAGCAGAGCGACATGATCCAGCGCATCGACGCCAATACGGAAGACGTGGTCGACAACGTCGAGGG
CGCCCAGCGCGAGCTGCTCAAGTACTGGACGCGCGTGTCGAGCAACCGGTGGCTTATTGCCAAGATGTTTGGCGT
CTTGATGATATTCTTTTTGTGAGTTGTTCGTCCTCAACTGCCGCTACGGACAAAGACTGACTCCGCGCGCCAGAC
TCTGGGTTCTCGTGTCGGGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail