Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4670
Gene name
Locationscaffold_371:18871..20274
Strand-
Gene length (bp)1403
Transcript length (bp)1215
Coding sequence length (bp)1212
Protein length (aa) 404

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00650 CRAL_TRIO CRAL/TRIO domain 2.0E-21 112 288

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P33324|YKJ1_YEAST CRAL-TRIO domain-containing protein YKL091C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKL091C PE=1 SV=2 11 289 4.0E-24
sp|P24280|SEC14_YEAST SEC14 cytosolic factor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC14 PE=1 SV=3 20 297 4.0E-23
sp|P53989|SEC14_CANGA SEC14 cytosolic factor OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC14 PE=3 SV=1 9 297 6.0E-18
sp|Q75DK1|SEC14_ASHGO SEC14 cytosolic factor OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEC14 PE=3 SV=2 20 297 7.0E-18
sp|P45816|SEC14_YARLI SEC14 cytosolic factor OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC14 PE=3 SV=2 7 341 2.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P33324|YKJ1_YEAST CRAL-TRIO domain-containing protein YKL091C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKL091C PE=1 SV=2 11 289 4.0E-24
sp|P24280|SEC14_YEAST SEC14 cytosolic factor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC14 PE=1 SV=3 20 297 4.0E-23
sp|P53989|SEC14_CANGA SEC14 cytosolic factor OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC14 PE=3 SV=1 9 297 6.0E-18
sp|Q75DK1|SEC14_ASHGO SEC14 cytosolic factor OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEC14 PE=3 SV=2 20 297 7.0E-18
sp|P45816|SEC14_YARLI SEC14 cytosolic factor OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC14 PE=3 SV=2 7 341 2.0E-17
sp|P24859|SEC14_KLULA SEC14 cytosolic factor OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SEC14 PE=3 SV=2 20 288 2.0E-16
sp|Q9SIW3|SFH7_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH7 OS=Arabidopsis thaliana GN=SFH7 PE=2 SV=2 50 288 2.0E-16
sp|P46250|SEC14_CANAL SEC14 cytosolic factor OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC14 PE=2 SV=1 20 314 8.0E-16
sp|Q10137|SEC14_SCHPO Sec14 cytosolic factor OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec14 PE=3 SV=1 18 289 2.0E-15
sp|F4JYJ3|SFH11_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH11 OS=Arabidopsis thaliana GN=SFH11 PE=3 SV=1 28 289 3.0E-15
sp|Q16KN5|RETM_AEDAE Protein real-time OS=Aedes aegypti GN=retm PE=3 SV=1 13 304 1.0E-14
sp|Q7PWB1|RETM_ANOGA Protein real-time OS=Anopheles gambiae GN=retm PE=3 SV=4 13 291 5.0E-14
sp|F4JLE5|SFH1_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH1 OS=Arabidopsis thaliana GN=SFH1 PE=2 SV=1 51 288 6.0E-14
sp|Q03606|YN02_CAEEL CRAL-TRIO domain-containing protein T23G5.2 OS=Caenorhabditis elegans GN=T23G5.2 PE=3 SV=3 11 289 7.0E-14
sp|Q29JQ0|RETM_DROPS Protein real-time OS=Drosophila pseudoobscura pseudoobscura GN=retm PE=3 SV=1 22 307 2.0E-13
sp|Q99MS0|S14L2_RAT SEC14-like protein 2 OS=Rattus norvegicus GN=Sec14l2 PE=1 SV=1 20 290 3.0E-13
sp|F4IHJ0|SFH8_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH8 OS=Arabidopsis thaliana GN=SFH8 PE=2 SV=1 51 288 3.0E-13
sp|F4JVA6|SFH6_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH6 OS=Arabidopsis thaliana GN=SFH6 PE=2 SV=1 31 288 7.0E-13
sp|O43304|S14L5_HUMAN SEC14-like protein 5 OS=Homo sapiens GN=SEC14L5 PE=2 SV=3 13 304 7.0E-13
sp|Q93ZE9|SFH3_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH3 OS=Arabidopsis thaliana GN=SFH3 PE=2 SV=1 31 289 1.0E-12
sp|Q99J08|S14L2_MOUSE SEC14-like protein 2 OS=Mus musculus GN=Sec14l2 PE=1 SV=1 20 290 1.0E-12
sp|Q0V9N0|S14L5_XENTR SEC14-like protein 5 OS=Xenopus tropicalis GN=sec14l1 PE=2 SV=1 13 304 1.0E-12
sp|P58875|S14L2_BOVIN SEC14-like protein 2 OS=Bos taurus GN=SEC14L2 PE=1 SV=2 20 290 2.0E-12
sp|F4HP88|SFH4_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH4 OS=Arabidopsis thaliana GN=SFH4 PE=2 SV=1 51 289 3.0E-12
sp|F4K6D3|SFH14_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH14 OS=Arabidopsis thaliana GN=SFH14 PE=2 SV=1 50 288 1.0E-11
sp|O76054|S14L2_HUMAN SEC14-like protein 2 OS=Homo sapiens GN=SEC14L2 PE=1 SV=1 20 290 4.0E-10
sp|Q9SI13|SFH10_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH10 OS=Arabidopsis thaliana GN=SFH10 PE=3 SV=1 51 289 4.0E-10
sp|F4J7S8|SFH9_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH9 OS=Arabidopsis thaliana GN=SFH9 PE=2 SV=1 27 289 5.0E-10
sp|Q9SCU1|PATL6_ARATH Patellin-6 OS=Arabidopsis thaliana GN=PATL6 PE=2 SV=1 22 298 1.0E-09
sp|Q757H2|CSR1_ASHGO Phosphatidylinositol transfer protein CSR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CSR1 PE=3 SV=2 56 313 2.0E-09
sp|Q8GXC6|SFH5_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH5 OS=Arabidopsis thaliana GN=SFH5 PE=2 SV=1 32 289 4.0E-09
sp|Q06705|CSR1_YEAST Phosphatidylinositol transfer protein CSR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSR1 PE=1 SV=1 56 304 2.0E-08
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.7086 0.3888 0.0411 0.0653 0.3035 0.0901 0.298 0.3427 0.3974 0.0087

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6505
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|06266
Ophiocordyceps camponoti-rufipedis Ophun1|1709
Ophiocordyceps kimflemingae Ophio5|4670 (this protein)
Ophiocordyceps subramaniannii Hirsu2|10892

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4670
MTKTTASSSPTSLVSEYPRGHVGHLTSSQQEALGQFKALLEAQGLWRRGPPVSLDDGNLLRFLRARQWIPDNAAE
QFRSSLNWLTVADMDKLRSTLDVEDWKQSRASVPAWTGRRDKRGQPVYYVDAGAAKEKAWTENGQASAIRAFCAQ
RSKSGASASMLTSMLHLDMMNSIIAPMCTRTTDRLHPEVPVTMTTYIADIGGLSLRKFWAIKNHVFCLLTSISVI
FPETASRIFIVCAPPYVGIMWSWVKSWLDPVTASKVVILKTQDVKPALESFIDLSSIPVRYGGTLDSDFSNGPVL
DESLRNAVDWEPGFDTLPSGPLSVETDGDRLACYTCGREKGKPRRQKVFTMPGPVECSNVSTEEMGAISVQHVGE
PDFVSGMSSELNEKQAIECLAVSAASVAA
Coding >Ophio5|4670
ATGACGAAAACCACAGCCAGCTCATCGCCAACCAGCCTGGTTTCCGAGTATCCTCGCGGTCATGTCGGCCACCTG
ACTTCTTCCCAGCAGGAGGCCCTCGGGCAGTTCAAGGCGCTGCTCGAGGCACAAGGGTTGTGGAGGCGCGGTCCG
CCGGTATCACTCGACGATGGAAACCTGCTCCGCTTCCTCCGCGCTCGCCAATGGATCCCCGACAATGCCGCCGAG
CAGTTCAGGAGCAGCCTCAACTGGCTCACCGTCGCCGACATGGACAAGCTTCGTTCGACGCTGGACGTCGAGGAT
TGGAAGCAATCGCGCGCATCGGTTCCCGCCTGGACCGGCCGACGAGATAAACGCGGCCAGCCCGTCTATTACGTC
GACGCCGGAGCAGCCAAGGAAAAAGCGTGGACGGAGAACGGACAAGCGAGCGCGATAAGGGCCTTTTGCGCCCAA
AGATCAAAATCCGGGGCATCGGCCTCGATGCTGACGTCGATGCTTCATCTCGACATGATGAACAGCATCATTGCT
CCCATGTGTACCAGGACGACGGATAGGCTTCATCCCGAGGTTCCCGTCACCATGACGACGTACATCGCTGACATT
GGCGGCCTTTCTCTGCGCAAGTTCTGGGCCATCAAGAATCACGTCTTCTGTCTCCTGACGAGCATCTCCGTCATC
TTCCCCGAGACGGCTTCACGCATCTTCATCGTCTGCGCTCCACCCTACGTCGGCATCATGTGGAGCTGGGTAAAG
TCCTGGCTCGACCCCGTCACCGCTTCCAAAGTCGTCATCCTCAAAACGCAAGACGTGAAACCGGCTCTCGAGTCT
TTCATCGACCTGAGCAGCATCCCCGTCCGATACGGCGGCACCTTGGACTCCGACTTTAGCAATGGTCCTGTCCTG
GATGAGAGTCTGCGTAATGCCGTCGACTGGGAGCCCGGCTTTGACACCCTGCCGTCTGGTCCTCTTTCCGTCGAG
ACCGATGGTGACCGGCTCGCTTGCTATACCTGTGGCCGGGAAAAGGGCAAACCCCGTCGGCAAAAGGTGTTTACC
ATGCCGGGGCCGGTCGAATGCAGCAACGTGTCGACGGAGGAGATGGGCGCCATCAGTGTTCAGCATGTCGGCGAG
CCAGACTTTGTCAGCGGAATGTCGAGCGAGCTGAATGAGAAGCAGGCTATTGAGTGCCTCGCCGTCTCTGCAGCG
TCCGTGGCGGCG
Transcript >Ophio5|4670
ATGACGAAAACCACAGCCAGCTCATCGCCAACCAGCCTGGTTTCCGAGTATCCTCGCGGTCATGTCGGCCACCTG
ACTTCTTCCCAGCAGGAGGCCCTCGGGCAGTTCAAGGCGCTGCTCGAGGCACAAGGGTTGTGGAGGCGCGGTCCG
CCGGTATCACTCGACGATGGAAACCTGCTCCGCTTCCTCCGCGCTCGCCAATGGATCCCCGACAATGCCGCCGAG
CAGTTCAGGAGCAGCCTCAACTGGCTCACCGTCGCCGACATGGACAAGCTTCGTTCGACGCTGGACGTCGAGGAT
TGGAAGCAATCGCGCGCATCGGTTCCCGCCTGGACCGGCCGACGAGATAAACGCGGCCAGCCCGTCTATTACGTC
GACGCCGGAGCAGCCAAGGAAAAAGCGTGGACGGAGAACGGACAAGCGAGCGCGATAAGGGCCTTTTGCGCCCAA
AGATCAAAATCCGGGGCATCGGCCTCGATGCTGACGTCGATGCTTCATCTCGACATGATGAACAGCATCATTGCT
CCCATGTGTACCAGGACGACGGATAGGCTTCATCCCGAGGTTCCCGTCACCATGACGACGTACATCGCTGACATT
GGCGGCCTTTCTCTGCGCAAGTTCTGGGCCATCAAGAATCACGTCTTCTGTCTCCTGACGAGCATCTCCGTCATC
TTCCCCGAGACGGCTTCACGCATCTTCATCGTCTGCGCTCCACCCTACGTCGGCATCATGTGGAGCTGGGTAAAG
TCCTGGCTCGACCCCGTCACCGCTTCCAAAGTCGTCATCCTCAAAACGCAAGACGTGAAACCGGCTCTCGAGTCT
TTCATCGACCTGAGCAGCATCCCCGTCCGATACGGCGGCACCTTGGACTCCGACTTTAGCAATGGTCCTGTCCTG
GATGAGAGTCTGCGTAATGCCGTCGACTGGGAGCCCGGCTTTGACACCCTGCCGTCTGGTCCTCTTTCCGTCGAG
ACCGATGGTGACCGGCTCGCTTGCTATACCTGTGGCCGGGAAAAGGGCAAACCCCGTCGGCAAAAGGTGTTTACC
ATGCCGGGGCCGGTCGAATGCAGCAACGTGTCGACGGAGGAGATGGGCGCCATCAGTGTTCAGCATGTCGGCGAG
CCAGACTTTGTCAGCGGAATGTCGAGCGAGCTGAATGAGAAGCAGGCTATTGAGTGCCTCGCCGTCTCTGCAGCG
TCCGTGGCGGCGTAA
Gene >Ophio5|4670
ATGACGAAAACCACAGCCAGCTCATCGCCAACCAGCCTGGTTTCCGAGTATCCTCGCGGTCATGTCGGCCACCTG
ACTTCTTCCCAGCAGGAGGCCCTCGGGCAGTTCAAGGCGCTGCTCGAGGCACAAGGGTTGTGGAGGCGCGGTCCG
CCGGTATCACTCGACGATGGAAACCTGCTGTACGAGAACTCTTTTCTTTTCCTTTTTATTATTTTTTATTTTGGT
CTTCCCTTGCCTCTCCGATCCCATCTTCTTTTTGATGATGGAAGCCCTGACGCATGGTAACTGCAGCCGCTTCCT
CCGCGCTCGCCAATGGATCCCCGACAATGCCGCCGAGCAGTTCAGGAGCAGCCTCAACTGGCTCACCGTCGCCGA
CATGGACAAGCTTCGTTCGACGCTGGACGTCGAGGATTGGAAGCAATCGCGCGCATCGGTTCGTCACAGGATATA
ATCTACATATACACATATATGTATATCTTCCATTGCCACCTAATGAATTTCCTCTTCAGGTTCCCGCCTGGACCG
GCCGACGAGATAAACGCGGCCAGCCCGTCTATTACGTCGACGCCGGAGCAGCCAAGGAAAAAGCGTGGACGGAGA
ACGGACAAGCGAGCGCGATAAGGGCCTTTTGCGCCCAAAGATCAAAATCCGGGGCATCGGCCTCGATGCTGACGT
CGATGCTTCATCTCGACATGATGAACAGCATCATTGCTCCCATGTGTACCAGGACGACGGATAGGCTTCATCCCG
AGGTTCCCGTCACCATGACGACGTACATCGCTGACATTGGCGGCCTTTCTCTGCGCAAGTTCTGGGCCATCAAGA
ATCACGTCTTCTGTCTCCTGACGAGCATCTCCGTCATCTTCCCCGAGACGGCTTCACGCATCTTCATCGTCTGCG
CTCCACCCTACGTCGGCATCATGTGGAGCTGGGTAAAGTCCTGGCTCGACCCCGTCACCGCTTCCAAAGTCGTCA
TCCTCAAAACGCAAGACGTGAAACCGGCTCTCGAGTCTTTCATCGACCTGAGCAGCATCCCCGTCCGATACGGCG
GCACCTTGGACTCCGACTTTAGCAATGGTCCTGTCCTGGATGAGAGTCTGCGTAATGCCGTCGACTGGGAGCCCG
GCTTTGACACCCTGCCGTCTGGTCCTCTTTCCGTCGAGACCGATGGTGACCGGCTCGCTTGCTATACCTGTGGCC
GGGAAAAGGGCAAACCCCGTCGGCAAAAGGTGTTTACCATGCCGGGGCCGGTCGAATGCAGCAACGTGTCGACGG
AGGAGATGGGCGCCATCAGTGTTCAGCATGTCGGCGAGCCAGACTTTGTCAGCGGAATGTCGAGCGAGCTGAATG
AGAAGCAGGCTATTGAGTGCCTCGCCGTCTCTGCAGCGTCCGTGGCGGCGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail