Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|467
Gene name
Locationscaffold_1103:1109..3440
Strand+
Gene length (bp)2331
Transcript length (bp)2331
Coding sequence length (bp)2328
Protein length (aa) 776

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|A2VD00|EIF3A_XENLA Eukaryotic translation initiation factor 3 subunit A OS=Xenopus laevis GN=eif3a PE=2 SV=1 581 750 5.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 0.02 0.0 0.14
CcL In ants, during behavior modification 0.00 0.0 0.00
CcD In ants, recently dead 0.15 0.0 0.40

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 1.0 no
SC16a CcD 1.0 no
CcL CcD 1.0 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|467
MRRLLALGLATVSPVGLAEATAHTDAASAPSRYQADKFASHTAHLATPIRYDECQDAIEQRFPHRDERTKLCHQF
LVTGVLPDLSDTTHTQAEQFPQRCDRNKLLHVCRSQQSSHTSSSSFCLERLEVGLAQDPSGTWEFCRRHIISHDF
LAAENLNSLDSRSRALFDDCFQSQSEVTKACESIHAPESLELPDCHGVKDYEHVVRIFGASLQDACSSQDAASTE
NEMRTLQVKTNNNGLAAFKSTCDCHKLHSAGNEANSASPSSSSLSPNPSSLTTLRATSSTQMSAPIESDSLPTTR
LPAARRFDSPAFPQDTAPPASDEATAKSKMLYSRAKAKPQKSSAGAASFSGPYSSQSSHAVTQENHLTQSDINSL
LEHSDKFKFEIRNGLCAIHSMPDEARHVSWRLIYDLDVNVESKHRFRFEICNPSEHGRVVTKIQGQYIYGYALEV
NGGASVAGSVNPNGKNEILCDTGNLTYVTVHDKGIIDVRLAGEVVVENKGGIIFKCQSIHNCEESKCQADECNSN
LIASITPEEIASLEDEIPGPDDLDFESDFDPDGQAQGSGNRTHPRPGYETGDHRNDTSNGPDYGPEYGPGNSPDY
GPGNGPEYGPGTGPDYGPGNGPEYGPGTGPDYGPGNGPEYGPEYGPGTGPDYGPGNGSEYGAGNGPDYGPGNSPG
TSPDYNPGNGPEYGPDHEPATGPEYGIGPGGSDTRPGGPGPDYGLEPGSGPDNGTDYDPVNNPDYEPGMGPGYGM
GPGGSDTRXXXXXXXXXXXXXXXXWL
Coding >Ophio5|467
ATGAGACGCCTTCTCGCCCTTGGCCTCGCCACGGTCAGTCCCGTCGGCTTGGCTGAGGCTACCGCACATACGGAC
GCTGCCTCGGCTCCCTCTCGATATCAAGCAGATAAGTTTGCTTCACATACGGCACACCTCGCCACACCCATTCGC
TACGACGAGTGTCAAGATGCCATCGAGCAAAGGTTTCCCCATCGAGACGAGCGAACTAAACTCTGCCATCAGTTC
CTCGTCACAGGAGTACTTCCCGACCTATCAGACACCACACACACACAGGCTGAGCAGTTTCCTCAAAGGTGTGAC
AGAAACAAGCTACTACACGTCTGCCGTTCTCAACAAAGTTCCCACACCTCCTCCAGCTCATTCTGCCTAGAGAGG
CTCGAGGTAGGGCTCGCTCAGGATCCCAGTGGCACTTGGGAGTTTTGCAGAAGACACATCATCAGTCATGACTTC
CTTGCTGCGGAAAACCTGAACAGTCTAGACTCTCGTTCTCGAGCGCTCTTCGATGACTGCTTTCAGAGCCAGTCC
GAGGTGACCAAGGCCTGCGAATCCATCCATGCTCCGGAAAGTCTCGAGCTGCCTGACTGCCACGGCGTCAAGGAC
TACGAGCACGTCGTCCGCATATTCGGCGCCTCTCTCCAAGATGCCTGCAGCAGTCAGGATGCCGCCTCGACTGAG
AACGAGATGCGAACTCTACAAGTCAAAACGAACAACAACGGCCTTGCCGCTTTCAAGTCCACCTGTGACTGCCAT
AAGCTTCATTCAGCAGGCAACGAAGCTAACTCCGCCTCCCCCTCGTCTTCTTCTTTGTCACCCAACCCATCTTCC
CTCACCACTCTCAGGGCCACCTCTTCTACGCAGATGTCTGCCCCGATCGAGTCCGACTCCCTGCCTACTACCCGC
TTACCTGCCGCTCGTCGCTTCGACAGCCCGGCTTTCCCTCAGGACACAGCCCCTCCCGCTTCAGACGAGGCCACT
GCAAAGAGCAAGATGCTCTATTCCCGCGCCAAGGCCAAGCCGCAGAAGTCATCTGCCGGCGCCGCTTCCTTCTCC
GGGCCCTACAGTTCTCAGTCCTCACATGCGGTAACCCAAGAAAATCACCTCACGCAATCCGATATCAACTCTCTG
CTTGAGCACTCGGATAAGTTCAAGTTCGAGATCCGCAATGGCCTCTGTGCCATTCACAGCATGCCTGACGAGGCC
CGCCACGTCAGCTGGCGACTGATTTACGATCTGGACGTCAACGTCGAGTCCAAGCACAGGTTCCGCTTCGAGATC
TGCAATCCGTCGGAGCATGGCCGTGTCGTGACCAAGATCCAAGGACAATACATCTATGGTTACGCTCTCGAGGTC
AACGGCGGCGCCTCTGTCGCAGGCTCCGTCAACCCCAACGGTAAGAATGAGATTCTCTGCGACACTGGCAACCTG
ACGTACGTCACCGTTCACGACAAAGGCATCATCGACGTCAGGCTGGCCGGCGAAGTCGTTGTCGAGAACAAGGGA
GGCATCATCTTCAAATGCCAAAGCATCCACAACTGCGAGGAATCAAAGTGCCAAGCCGATGAATGCAATTCCAAC
CTCATCGCCTCCATCACGCCTGAAGAGATTGCCTCATTAGAGGACGAAATTCCGGGTCCTGATGACCTTGATTTT
GAGTCCGATTTTGATCCCGATGGCCAAGCTCAAGGTTCAGGCAACCGCACTCATCCTCGCCCAGGGTACGAGACT
GGAGACCACCGAAATGATACCAGCAACGGTCCAGACTACGGTCCCGAGTACGGTCCTGGCAACAGCCCGGACTAC
GGTCCCGGCAACGGTCCCGAGTACGGCCCCGGCACCGGCCCTGACTACGGTCCCGGCAACGGTCCCGAGTACGGC
CCCGGCACCGGCCCTGACTATGGTCCCGGAAACGGTCCCGAGTACGGTCCCGAGTACGGTCCCGGCACCGGCCCT
GACTATGGTCCCGGTAACGGTTCCGAGTACGGTGCCGGCAACGGTCCTGACTACGGTCCCGGCAACAGCCCTGGC
ACTAGTCCCGACTACAATCCCGGCAACGGTCCCGAGTACGGCCCTGACCACGAGCCGGCGACCGGCCCTGAATAT
GGTATAGGCCCTGGTGGCTCAGACACCCGCCCTGGAGGTCCTGGACCGGACTACGGTCTCGAGCCTGGGTCCGGG
CCTGACAATGGCACCGACTACGATCCCGTTAATAATCCTGACTATGAGCCCGGAATGGGTCCTGGATACGGCATG
GGCCCTGGTGGCTCTGATACCCGCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGG
CTC
Transcript >Ophio5|467
ATGAGACGCCTTCTCGCCCTTGGCCTCGCCACGGTCAGTCCCGTCGGCTTGGCTGAGGCTACCGCACATACGGAC
GCTGCCTCGGCTCCCTCTCGATATCAAGCAGATAAGTTTGCTTCACATACGGCACACCTCGCCACACCCATTCGC
TACGACGAGTGTCAAGATGCCATCGAGCAAAGGTTTCCCCATCGAGACGAGCGAACTAAACTCTGCCATCAGTTC
CTCGTCACAGGAGTACTTCCCGACCTATCAGACACCACACACACACAGGCTGAGCAGTTTCCTCAAAGGTGTGAC
AGAAACAAGCTACTACACGTCTGCCGTTCTCAACAAAGTTCCCACACCTCCTCCAGCTCATTCTGCCTAGAGAGG
CTCGAGGTAGGGCTCGCTCAGGATCCCAGTGGCACTTGGGAGTTTTGCAGAAGACACATCATCAGTCATGACTTC
CTTGCTGCGGAAAACCTGAACAGTCTAGACTCTCGTTCTCGAGCGCTCTTCGATGACTGCTTTCAGAGCCAGTCC
GAGGTGACCAAGGCCTGCGAATCCATCCATGCTCCGGAAAGTCTCGAGCTGCCTGACTGCCACGGCGTCAAGGAC
TACGAGCACGTCGTCCGCATATTCGGCGCCTCTCTCCAAGATGCCTGCAGCAGTCAGGATGCCGCCTCGACTGAG
AACGAGATGCGAACTCTACAAGTCAAAACGAACAACAACGGCCTTGCCGCTTTCAAGTCCACCTGTGACTGCCAT
AAGCTTCATTCAGCAGGCAACGAAGCTAACTCCGCCTCCCCCTCGTCTTCTTCTTTGTCACCCAACCCATCTTCC
CTCACCACTCTCAGGGCCACCTCTTCTACGCAGATGTCTGCCCCGATCGAGTCCGACTCCCTGCCTACTACCCGC
TTACCTGCCGCTCGTCGCTTCGACAGCCCGGCTTTCCCTCAGGACACAGCCCCTCCCGCTTCAGACGAGGCCACT
GCAAAGAGCAAGATGCTCTATTCCCGCGCCAAGGCCAAGCCGCAGAAGTCATCTGCCGGCGCCGCTTCCTTCTCC
GGGCCCTACAGTTCTCAGTCCTCACATGCGGTAACCCAAGAAAATCACCTCACGCAATCCGATATCAACTCTCTG
CTTGAGCACTCGGATAAGTTCAAGTTCGAGATCCGCAATGGCCTCTGTGCCATTCACAGCATGCCTGACGAGGCC
CGCCACGTCAGCTGGCGACTGATTTACGATCTGGACGTCAACGTCGAGTCCAAGCACAGGTTCCGCTTCGAGATC
TGCAATCCGTCGGAGCATGGCCGTGTCGTGACCAAGATCCAAGGACAATACATCTATGGTTACGCTCTCGAGGTC
AACGGCGGCGCCTCTGTCGCAGGCTCCGTCAACCCCAACGGTAAGAATGAGATTCTCTGCGACACTGGCAACCTG
ACGTACGTCACCGTTCACGACAAAGGCATCATCGACGTCAGGCTGGCCGGCGAAGTCGTTGTCGAGAACAAGGGA
GGCATCATCTTCAAATGCCAAAGCATCCACAACTGCGAGGAATCAAAGTGCCAAGCCGATGAATGCAATTCCAAC
CTCATCGCCTCCATCACGCCTGAAGAGATTGCCTCATTAGAGGACGAAATTCCGGGTCCTGATGACCTTGATTTT
GAGTCCGATTTTGATCCCGATGGCCAAGCTCAAGGTTCAGGCAACCGCACTCATCCTCGCCCAGGGTACGAGACT
GGAGACCACCGAAATGATACCAGCAACGGTCCAGACTACGGTCCCGAGTACGGTCCTGGCAACAGCCCGGACTAC
GGTCCCGGCAACGGTCCCGAGTACGGCCCCGGCACCGGCCCTGACTACGGTCCCGGCAACGGTCCCGAGTACGGC
CCCGGCACCGGCCCTGACTATGGTCCCGGAAACGGTCCCGAGTACGGTCCCGAGTACGGTCCCGGCACCGGCCCT
GACTATGGTCCCGGTAACGGTTCCGAGTACGGTGCCGGCAACGGTCCTGACTACGGTCCCGGCAACAGCCCTGGC
ACTAGTCCCGACTACAATCCCGGCAACGGTCCCGAGTACGGCCCTGACCACGAGCCGGCGACCGGCCCTGAATAT
GGTATAGGCCCTGGTGGCTCAGACACCCGCCCTGGAGGTCCTGGACCGGACTACGGTCTCGAGCCTGGGTCCGGG
CCTGACAATGGCACCGACTACGATCCCGTTAATAATCCTGACTATGAGCCCGGAATGGGTCCTGGATACGGCATG
GGCCCTGGTGGCTCTGATACCCGCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGG
CTCTGA
Gene >Ophio5|467
ATGAGACGCCTTCTCGCCCTTGGCCTCGCCACGGTCAGTCCCGTCGGCTTGGCTGAGGCTACCGCACATACGGAC
GCTGCCTCGGCTCCCTCTCGATATCAAGCAGATAAGTTTGCTTCACATACGGCACACCTCGCCACACCCATTCGC
TACGACGAGTGTCAAGATGCCATCGAGCAAAGGTTTCCCCATCGAGACGAGCGAACTAAACTCTGCCATCAGTTC
CTCGTCACAGGAGTACTTCCCGACCTATCAGACACCACACACACACAGGCTGAGCAGTTTCCTCAAAGGTGTGAC
AGAAACAAGCTACTACACGTCTGCCGTTCTCAACAAAGTTCCCACACCTCCTCCAGCTCATTCTGCCTAGAGAGG
CTCGAGGTAGGGCTCGCTCAGGATCCCAGTGGCACTTGGGAGTTTTGCAGAAGACACATCATCAGTCATGACTTC
CTTGCTGCGGAAAACCTGAACAGTCTAGACTCTCGTTCTCGAGCGCTCTTCGATGACTGCTTTCAGAGCCAGTCC
GAGGTGACCAAGGCCTGCGAATCCATCCATGCTCCGGAAAGTCTCGAGCTGCCTGACTGCCACGGCGTCAAGGAC
TACGAGCACGTCGTCCGCATATTCGGCGCCTCTCTCCAAGATGCCTGCAGCAGTCAGGATGCCGCCTCGACTGAG
AACGAGATGCGAACTCTACAAGTCAAAACGAACAACAACGGCCTTGCCGCTTTCAAGTCCACCTGTGACTGCCAT
AAGCTTCATTCAGCAGGCAACGAAGCTAACTCCGCCTCCCCCTCGTCTTCTTCTTTGTCACCCAACCCATCTTCC
CTCACCACTCTCAGGGCCACCTCTTCTACGCAGATGTCTGCCCCGATCGAGTCCGACTCCCTGCCTACTACCCGC
TTACCTGCCGCTCGTCGCTTCGACAGCCCGGCTTTCCCTCAGGACACAGCCCCTCCCGCTTCAGACGAGGCCACT
GCAAAGAGCAAGATGCTCTATTCCCGCGCCAAGGCCAAGCCGCAGAAGTCATCTGCCGGCGCCGCTTCCTTCTCC
GGGCCCTACAGTTCTCAGTCCTCACATGCGGTAACCCAAGAAAATCACCTCACGCAATCCGATATCAACTCTCTG
CTTGAGCACTCGGATAAGTTCAAGTTCGAGATCCGCAATGGCCTCTGTGCCATTCACAGCATGCCTGACGAGGCC
CGCCACGTCAGCTGGCGACTGATTTACGATCTGGACGTCAACGTCGAGTCCAAGCACAGGTTCCGCTTCGAGATC
TGCAATCCGTCGGAGCATGGCCGTGTCGTGACCAAGATCCAAGGACAATACATCTATGGTTACGCTCTCGAGGTC
AACGGCGGCGCCTCTGTCGCAGGCTCCGTCAACCCCAACGGTAAGAATGAGATTCTCTGCGACACTGGCAACCTG
ACGTACGTCACCGTTCACGACAAAGGCATCATCGACGTCAGGCTGGCCGGCGAAGTCGTTGTCGAGAACAAGGGA
GGCATCATCTTCAAATGCCAAAGCATCCACAACTGCGAGGAATCAAAGTGCCAAGCCGATGAATGCAATTCCAAC
CTCATCGCCTCCATCACGCCTGAAGAGATTGCCTCATTAGAGGACGAAATTCCGGGTCCTGATGACCTTGATTTT
GAGTCCGATTTTGATCCCGATGGCCAAGCTCAAGGTTCAGGCAACCGCACTCATCCTCGCCCAGGGTACGAGACT
GGAGACCACCGAAATGATACCAGCAACGGTCCAGACTACGGTCCCGAGTACGGTCCTGGCAACAGCCCGGACTAC
GGTCCCGGCAACGGTCCCGAGTACGGCCCCGGCACCGGCCCTGACTACGGTCCCGGCAACGGTCCCGAGTACGGC
CCCGGCACCGGCCCTGACTATGGTCCCGGAAACGGTCCCGAGTACGGTCCCGAGTACGGTCCCGGCACCGGCCCT
GACTATGGTCCCGGTAACGGTTCCGAGTACGGTGCCGGCAACGGTCCTGACTACGGTCCCGGCAACAGCCCTGGC
ACTAGTCCCGACTACAATCCCGGCAACGGTCCCGAGTACGGCCCTGACCACGAGCCGGCGACCGGCCCTGAATAT
GGTATAGGCCCTGGTGGCTCAGACACCCGCCCTGGAGGTCCTGGACCGGACTACGGTCTCGAGCCTGGGTCCGGG
CCTGACAATGGCACCGACTACGATCCCGTTAATAATCCTGACTATGAGCCCGGAATGGGTCCTGGATACGGCATG
GGCCCTGGTGGCTCTGATACCCGCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGG
CTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail