Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4651
Gene name
Locationscaffold_370:4259..4702
Strand-
Gene length (bp)443
Transcript length (bp)321
Coding sequence length (bp)318
Protein length (aa) 106

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03647 Tmemb_14 Transmembrane proteins 14C 6.0E-24 9 96

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P47131|YJ55_YEAST TMEM14 protein homolog YJR085C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJR085C PE=1 SV=1 5 104 5.0E-18
sp|Q75JB5|TM14_DICDI Transmembrane protein 14 homolog OS=Dictyostelium discoideum GN=DDB_G0271790 PE=3 SV=1 11 99 4.0E-15
sp|Q9P7G3|YK45_SCHPO TMEM14 protein homolog P14E8.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP14E8.05c PE=3 SV=1 6 98 1.0E-10

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 33 50 17
3 57 79 22
4 83 102 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4651
MPQQLEYSAYALAALTAGGGIMGFVRTQSKPSLIAGSAVGILYGLGGYRLQNNQPYGIELGLLASVILGGSSIPR
AIRLRKPVPIVLSILSTFGMLTFGNAYREKL
Coding >Ophio5|4651
ATGCCACAGCAATTGGAGTACTCGGCCTACGCGCTGGCGGCGCTGACCGCTGGCGGTGGTATTATGGGCTTTGTG
AGGACGCAGTCCAAGCCTTCGCTCATTGCTGGCTCAGCCGTCGGCATCCTCTACGGCCTCGGCGGCTACCGTTTG
CAAAACAATCAGCCCTACGGCATCGAGTTGGGCCTTCTAGCCTCCGTCATCCTCGGCGGCTCCTCGATCCCGCGA
GCCATCCGTCTCAGGAAGCCCGTGCCCATTGTCCTCAGCATCTTGTCGACCTTTGGCATGCTCACATTTGGCAAC
GCATACCGAGAGAAGCTG
Transcript >Ophio5|4651
ATGCCACAGCAATTGGAGTACTCGGCCTACGCGCTGGCGGCGCTGACCGCTGGCGGTGGTATTATGGGCTTTGTG
AGGACGCAGTCCAAGCCTTCGCTCATTGCTGGCTCAGCCGTCGGCATCCTCTACGGCCTCGGCGGCTACCGTTTG
CAAAACAATCAGCCCTACGGCATCGAGTTGGGCCTTCTAGCCTCCGTCATCCTCGGCGGCTCCTCGATCCCGCGA
GCCATCCGTCTCAGGAAGCCCGTGCCCATTGTCCTCAGCATCTTGTCGACCTTTGGCATGCTCACATTTGGCAAC
GCATACCGAGAGAAGCTGTGA
Gene >Ophio5|4651
ATGGTAGGGCCATCACTTCAGCCGAGCGCGCCCGAACTGCCTACTAGTAGAGGCAGCTAACAAGCGGCGCCGCAG
CCACAGCAATTGGAGTACTCGGCCTACGCGCTGGCGGCGCTGACCGCTGGCGGTGGTATTATGGGCTTTGTGAGG
ACGCAGTCCAAGCCTTCGCTCATTGCTGGCTCAGCCGTCGGCATCCTCTGTACGTTGGCTGATTCCTTCTGCTGC
GCCGACCGTCTAATCACTTCACAGACGGCCTCGGCGGCTACCGTTTGCAAAACAATCAGCCCTACGGCATCGAGT
TGGGCCTTCTAGCCTCCGTCATCCTCGGCGGCTCCTCGATCCCGCGAGCCATCCGTCTCAGGAAGCCCGTGCCCA
TTGTCCTCAGCATCTTGTCGACCTTTGGCATGCTCACATTTGGCAACGCATACCGAGAGAAGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail