Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4647
Gene name
Locationscaffold_37:60225..66971
Strand+
Gene length (bp)6746
Transcript length (bp)6579
Coding sequence length (bp)6576
Protein length (aa) 2192

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04054 Not1 CCR4-Not complex component, Not1 2.9E-128 1818 2188
PF16415 CNOT1_CAF1_bind CCR4-NOT transcription complex subunit 1 CAF1-binding domain 4.0E-91 919 1140
PF12842 DUF3819 CCR4-Not complex, Not1 subunit, domain of unknown function DUF3819 8.0E-46 1199 1338
PF16417 CNOT1_TTP_bind CCR4-NOT transcription complex subunit 1 TTP binding domain 1.2E-40 707 851
PF16418 CNOT1_HEAT CCR4-NOT transcription complex subunit 1 HEAT repeat 1.3E-37 516 663

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87112|NOT1_SCHPO General negative regulator of transcription subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=not1 PE=1 SV=1 20 2188 0.0E+00
sp|Q6ZQ08|CNOT1_MOUSE CCR4-NOT transcription complex subunit 1 OS=Mus musculus GN=Cnot1 PE=1 SV=2 700 2190 2.0E-158
sp|A5YKK6|CNOT1_HUMAN CCR4-NOT transcription complex subunit 1 OS=Homo sapiens GN=CNOT1 PE=1 SV=2 700 2190 3.0E-158
sp|P25655|NOT1_YEAST General negative regulator of transcription subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC39 PE=1 SV=3 1189 2181 1.0E-95
sp|A1A5H6|CNOT1_DANRE CCR4-NOT transcription complex subunit 1 OS=Danio rerio GN=cnot1 PE=2 SV=1 700 1384 1.0E-84
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87112|NOT1_SCHPO General negative regulator of transcription subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=not1 PE=1 SV=1 20 2188 0.0E+00
sp|Q6ZQ08|CNOT1_MOUSE CCR4-NOT transcription complex subunit 1 OS=Mus musculus GN=Cnot1 PE=1 SV=2 700 2190 2.0E-158
sp|A5YKK6|CNOT1_HUMAN CCR4-NOT transcription complex subunit 1 OS=Homo sapiens GN=CNOT1 PE=1 SV=2 700 2190 3.0E-158
sp|P25655|NOT1_YEAST General negative regulator of transcription subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC39 PE=1 SV=3 1189 2181 1.0E-95
sp|A1A5H6|CNOT1_DANRE CCR4-NOT transcription complex subunit 1 OS=Danio rerio GN=cnot1 PE=2 SV=1 700 1384 1.0E-84
sp|A0JP85|CNOT1_XENTR CCR4-NOT transcription complex subunit 1 OS=Xenopus tropicalis GN=cnot1 PE=2 SV=1 700 1384 2.0E-84
sp|P25655|NOT1_YEAST General negative regulator of transcription subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC39 PE=1 SV=3 682 1141 4.0E-80
sp|A0JP85|CNOT1_XENTR CCR4-NOT transcription complex subunit 1 OS=Xenopus tropicalis GN=cnot1 PE=2 SV=1 1544 2190 3.0E-66
sp|A1A5H6|CNOT1_DANRE CCR4-NOT transcription complex subunit 1 OS=Danio rerio GN=cnot1 PE=2 SV=1 1581 2190 3.0E-64
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
CCR4-Not complex component, Not1

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4647
MVPPPRAGSFSPNPAQTLQTGTGHSPHPSHAGVLSAGASPSTSSPTGTNSLTKIVVAQVYLLLSTIKEDKDRAKW
EIQVDQLRKLIDEHGMEVFSKYFTRLVAGNAPQIFPGLNRPVANPGNYHILAAEMRKIAHDTGQAGKIAESVESG
TEDIFRDFDLSTFMEHFKLDALEKTLLALAFKTGSRSDLKTKADAILSTNFPSFMDIISRPDIEAHADLTPAFVA
FIVDRFLQYHPPSFNVSSRRDLHNYVVKRYVSMDQPPPSQVLSALDVGRVLADRPANVLARYIQRTGADFTRDEE
TCFSYLQGRPNSMQLSPDQVSAALIFTTITQSPHHDPSVLTAALQRVLPKSFEWNEVIMFFDQPSARISSSQFLR
LYKALLPIAQDPKRNLDIQRLWGGSWSEPEAQLSFVSAYGSLTPDQLDATTIPRLHRSINIDEYANASPSVQERA
AVAVKHPLVSVAALSAIFNVALNSVHASQSVEAKRLFQEVVVPNLDIFLVSAFEVPRQSWASMAVDTLNSLFENF
LYKRSPEYDFVFDSLWKKDREWVVQRLIDAHAVKPIDLPLVYEHAVKLGWLDDLVYLPNGFGIDLAAYAHAQGHL
DLANWARFNADRSAEIARTLLQFLMIKANLEIQFQRPPDGQAAVKTSTSLQVRTVSALLQILEDFLPGAPVQDLI
LVQRHCITAYPRLINYGEGYDDVIDANGRDGNALPQAANSKMEEHYKKMYGDELQVRTIVEILDRYKRSREPLDQ
DAFACMIHGLFDEYNHYVDYPLEALATTAVLFGGIISHKLIAELPLQIGLGMILEAVRDHMPDDPMYKFGLQALM
QLLVRFREWPGFCEQLLQIPGLQGTEAYKKAEEIVRDHEKEVVRSRNGAGTPRGLNFAGDSFVNGNTDEPVASDR
QAPPFAAIGVEAVPVGADSEQPGDEEQGKIQFVLNNITEGTLQSMRNELREMLERKHQQWFASHLVEERAKMQPN
YHHVYLELVKLFEDNALWHEVLRETFISVARMLNSELTLQNSTERTHLKNLGGWLGLLTLARDKPIKHKNIAFKQ
LLIEAHDTKRLIVVIPFVCKVLIQGATSQVFRPPNPWLMDIIHLLIELYHHAELKLNLKFEIEVLCKGLNLDHKS
IEPSGEILNRPSADEAAEVLPQDQPDAFENLPLNGIGSVVGSGLSPQAVAPTIPDVGPLITIPPTNEMVVSTTRL
HEIVEAALTRALQDIIQPVVDRSITIASISTVQMIRKDFVSEPDENRLRTSAVNMVKATAGSLALVTSKEPLRAN
MTNYMRSLANDLPSGLPEGTIIMCVNSNLDLACSIIEKQAEERAVPDIEELLEEDTATRRLHRIQQPNEPFYSGN
VNRWGMTIPNPYKLSPNLNGLNPEQMAIYEDFARQPRNATTSGPSHAPSTSDATRSLANEVLQESYNAVPALPTP
AETPSMPHMGPQLQPYGPVHAATNTMAGGRAASFQMDVRGLADRVNKLLQELMRVSGEAREEHFAGLPRPHSVLD
VVDALVQLIIKTSQSSEEFVIYAAEQISNLIFQQVDDNLALESLVHVLETLRKISGPALNNRVRSIFCQQPGATF
LSIPLLEALARTDLVEWRNLDLAMSQVVEGRKEGSLEFLEHMLDLALLNDRPVALYADFARTLEMAWAWICDDGS
SPAGQRLKSKLLGSSLPLASRGADGDEAAVRQDQMEYVFEEWVHLCNNQNASAKATTFFMQQLQAKQIIRGRDDL
FVFVRIALDLVVDRFDHMPLQSRAVAEPKYMMVDALAKLITIFVTMHNEDSTSRTAFLDSVLVLLGLVLSHHHME
RPEHLNQRVFFRLFSMILHEMQNASEEFTEEEQQQMMLRFAKRFQSIGPLRLPGFAFSWLGLIQHRAFLPLLMQV
PGGSGWEPCVNLMVQLLNCLGEQLKTFTVSPVTKELYRATLKFLIVLQHDYPDFLAASHMKLCAHIPAHCTQLLN
TILAANPQQHYGKLPDPMYPGLKVDRMEDMKTHPGLMVEAVATLRECGLLGVLDHVLQSGPTEDAVAQMAHAMTH
KVPEDTAFGHVAVAANAEVIGAVVIYTGQHAAGRATSTSSAIPVNSGESDVSVMSLLVHELPPEARYYLLSSMAN
QLRYPCAHTEYFSQLILYMFGKDLNDPEESDIRQEIARVLLERLVGFWPQPWGLMFTVLELVKNDKYMFFELPFV
KSTPEVADRFAAVLQRA
Coding >Ophio5|4647
ATGGTGCCTCCACCACGAGCGGGATCCTTTTCGCCAAATCCTGCACAGACTCTTCAAACGGGCACCGGGCACTCG
CCGCACCCCTCTCACGCTGGCGTCCTGAGTGCTGGCGCCAGCCCCAGCACCAGCAGCCCGACTGGGACCAACTCT
TTGACCAAGATCGTTGTGGCCCAAGTCTATCTCCTGCTCAGCACCATCAAGGAGGACAAGGACCGTGCCAAGTGG
GAAATCCAGGTGGATCAGTTACGAAAGCTCATCGATGAACACGGCATGGAAGTCTTTTCCAAATACTTCACCCGT
CTAGTAGCGGGCAATGCGCCCCAGATATTCCCTGGCCTCAACAGGCCTGTTGCGAATCCGGGAAATTACCACATT
CTCGCCGCCGAGATGCGCAAAATCGCCCATGACACCGGTCAAGCTGGCAAGATAGCCGAGTCCGTCGAGAGCGGC
ACCGAGGACATCTTTCGCGATTTCGACCTCTCCACCTTTATGGAACATTTCAAGCTCGATGCGCTCGAGAAGACC
CTGTTGGCCCTGGCGTTCAAGACAGGATCGCGGTCCGACCTCAAGACCAAAGCCGATGCCATTTTGTCGACCAAT
TTTCCGTCCTTCATGGACATCATATCGCGCCCCGACATCGAGGCTCATGCGGACCTAACGCCGGCCTTTGTAGCC
TTTATCGTCGATCGATTCCTCCAATATCATCCTCCTAGCTTTAACGTTTCGTCCAGACGGGATCTACACAACTAC
GTCGTTAAGCGTTACGTCAGTATGGATCAGCCGCCTCCTTCCCAGGTTCTTTCCGCCCTCGATGTCGGCAGAGTC
CTCGCCGACAGGCCGGCAAACGTCTTGGCCCGATATATTCAGAGGACCGGTGCCGATTTCACTCGCGACGAGGAG
ACGTGCTTCTCGTACTTGCAAGGCCGCCCAAACAGCATGCAGCTCAGTCCCGATCAGGTGTCGGCGGCACTCATC
TTTACAACAATCACCCAGAGCCCCCACCACGACCCGTCGGTGCTCACAGCTGCCCTGCAGCGCGTACTCCCCAAG
TCATTTGAGTGGAACGAGGTCATCATGTTCTTTGACCAGCCGTCGGCCCGCATCTCGTCGTCTCAGTTCCTGCGT
CTCTACAAGGCTTTGCTGCCCATCGCTCAGGACCCAAAGCGCAACTTGGACATTCAGCGGCTGTGGGGCGGCTCG
TGGAGCGAGCCCGAGGCTCAGCTCTCCTTCGTCAGTGCGTACGGGTCGTTGACACCAGATCAGCTCGACGCGACG
ACGATCCCGCGCTTGCACCGAAGCATCAACATTGACGAATACGCCAACGCTTCGCCGAGCGTGCAAGAGCGGGCC
GCGGTGGCCGTCAAGCATCCTCTGGTCTCCGTCGCTGCCCTCTCCGCCATTTTCAATGTTGCCCTCAACTCGGTC
CATGCTTCGCAGAGCGTCGAGGCTAAACGGCTGTTTCAGGAAGTGGTGGTGCCCAACCTCGACATCTTCTTGGTG
TCTGCCTTTGAGGTTCCGCGACAATCCTGGGCGTCAATGGCAGTCGACACACTGAACTCGCTCTTCGAGAACTTC
CTGTACAAACGGTCCCCCGAGTACGACTTTGTGTTCGACAGCCTTTGGAAGAAGGACCGCGAGTGGGTTGTTCAG
CGGCTCATTGACGCTCACGCCGTGAAGCCCATCGATCTGCCTTTGGTCTATGAGCATGCCGTTAAACTGGGTTGG
CTTGATGACTTGGTCTATCTTCCCAATGGCTTCGGCATCGATCTCGCCGCCTACGCGCACGCCCAGGGCCATCTT
GATCTGGCAAATTGGGCGCGTTTCAACGCAGACAGAAGCGCGGAGATTGCGCGCACCCTGCTACAGTTTTTGATG
ATCAAGGCCAACCTGGAGATTCAGTTCCAGCGGCCGCCCGACGGTCAGGCCGCGGTGAAGACGAGCACCAGCTTG
CAGGTCCGGACCGTCTCTGCCTTGCTGCAAATACTGGAAGACTTCCTGCCTGGAGCGCCGGTCCAAGATCTGATC
CTCGTACAACGCCACTGCATCACAGCATACCCCCGACTCATCAACTACGGCGAAGGCTACGACGACGTCATCGAT
GCGAATGGCAGGGACGGCAACGCCTTGCCGCAAGCCGCCAACAGCAAAATGGAAGAGCACTACAAGAAGATGTAC
GGCGACGAACTTCAGGTTCGCACCATCGTGGAGATTCTGGACCGCTACAAGCGCTCACGGGAGCCCCTGGATCAG
GACGCCTTCGCCTGCATGATCCACGGTCTCTTTGACGAGTACAATCACTACGTCGACTACCCCCTGGAGGCTCTG
GCCACGACGGCAGTCCTTTTTGGCGGGATAATATCCCACAAGTTGATTGCAGAACTCCCCCTGCAAATCGGTCTC
GGCATGATCCTCGAAGCGGTCAGGGATCACATGCCCGATGACCCCATGTACAAGTTTGGCCTCCAGGCCTTGATG
CAGCTCCTGGTCCGCTTCAGGGAATGGCCCGGCTTCTGCGAGCAACTGCTGCAGATCCCCGGCTTGCAAGGCACG
GAAGCTTATAAAAAGGCCGAGGAGATTGTCAGGGACCACGAGAAGGAGGTGGTGCGCTCGCGCAACGGCGCCGGC
ACGCCGCGCGGTCTTAACTTCGCCGGCGACTCTTTCGTCAACGGCAACACCGACGAGCCCGTGGCCAGCGATCGC
CAAGCTCCTCCGTTCGCGGCCATCGGAGTCGAGGCTGTCCCCGTCGGCGCTGATTCTGAACAGCCCGGTGACGAG
GAGCAGGGCAAGATTCAGTTCGTTCTCAATAACATTACCGAGGGAACCCTACAGTCGATGCGCAATGAGCTGCGC
GAGATGCTGGAACGCAAGCACCAACAATGGTTCGCCAGCCATCTCGTCGAAGAGCGCGCCAAAATGCAGCCCAAC
TACCACCACGTCTACCTGGAGCTTGTGAAGCTCTTCGAGGACAACGCCCTGTGGCACGAGGTCCTCCGCGAAACC
TTCATCAGCGTTGCCCGGATGCTCAACTCGGAGCTCACATTGCAGAACTCGACGGAAAGGACCCATCTTAAGAAT
CTCGGAGGCTGGCTCGGCCTCCTAACTCTGGCGCGGGACAAGCCGATCAAGCACAAGAACATCGCCTTCAAGCAG
TTGTTGATCGAGGCACACGATACTAAGAGGCTCATTGTCGTCATACCCTTCGTGTGCAAGGTCCTGATCCAAGGC
GCCACGTCGCAAGTGTTCCGGCCCCCGAACCCCTGGCTCATGGACATAATACATCTCCTCATCGAGCTGTACCAT
CATGCCGAACTCAAATTGAACCTCAAATTCGAGATCGAGGTCCTCTGCAAGGGGCTGAACCTCGACCACAAGAGC
ATCGAACCGTCGGGAGAGATCCTGAACCGCCCCTCGGCGGACGAGGCAGCCGAGGTGCTGCCCCAAGACCAGCCG
GATGCCTTCGAAAACCTGCCACTGAATGGCATCGGCTCTGTCGTCGGCTCGGGCCTGTCTCCGCAGGCCGTCGCG
CCCACCATCCCCGACGTCGGCCCCCTGATCACGATTCCGCCGACAAACGAGATGGTAGTCAGCACCACGCGCCTG
CACGAGATTGTCGAGGCCGCCTTGACCCGGGCTCTGCAAGACATCATCCAGCCTGTCGTCGATAGGTCCATAACG
ATTGCTTCGATATCTACTGTGCAGATGATACGCAAGGATTTCGTATCGGAGCCCGACGAGAACCGCCTGCGGACG
TCGGCCGTGAACATGGTCAAAGCGACTGCGGGCAGCCTGGCCCTTGTCACGTCCAAGGAACCCTTGCGCGCAAAC
ATGACGAATTATATGCGAAGCCTCGCCAACGACCTACCTTCGGGCCTTCCGGAAGGGACCATCATCATGTGCGTC
AACTCGAACCTCGACCTGGCGTGCAGCATCATCGAGAAGCAGGCCGAGGAGAGGGCAGTGCCGGATATCGAAGAG
CTTCTGGAGGAAGACACGGCAACGAGGAGGCTCCATCGTATCCAGCAGCCAAACGAGCCCTTCTACTCGGGCAAC
GTCAACCGTTGGGGAATGACAATCCCAAATCCGTACAAGCTGTCGCCCAACCTGAACGGTCTCAACCCGGAGCAG
ATGGCGATATACGAGGACTTTGCCCGACAGCCGCGAAACGCCACGACGTCGGGACCTTCGCATGCACCCTCGACG
TCAGACGCCACTCGATCCCTGGCCAACGAGGTGCTGCAGGAATCCTACAACGCCGTGCCCGCCCTCCCAACACCG
GCCGAGACGCCTTCGATGCCGCACATGGGACCCCAACTGCAACCATACGGTCCGGTTCATGCGGCCACCAACACG
ATGGCGGGCGGGCGGGCGGCCAGCTTCCAGATGGACGTGCGTGGCCTGGCTGATCGGGTGAACAAGCTGCTTCAG
GAGCTCATGCGCGTCTCGGGCGAGGCTCGCGAAGAGCATTTTGCGGGCCTCCCGAGACCGCATTCCGTCCTCGAT
GTGGTCGACGCCCTGGTGCAGCTCATCATCAAGACGTCGCAAAGCTCCGAGGAGTTTGTCATATACGCCGCGGAG
CAGATCAGCAACCTCATCTTCCAACAGGTGGACGACAACCTGGCCCTGGAAAGCCTGGTGCACGTGCTCGAGACT
CTGAGGAAGATTTCCGGTCCGGCGCTCAACAACCGCGTCCGGTCCATCTTCTGCCAGCAGCCCGGCGCCACGTTT
CTCAGTATACCTCTCCTGGAGGCGCTGGCAAGGACCGACCTCGTGGAGTGGCGAAATCTGGACCTGGCCATGTCC
CAGGTAGTCGAAGGCCGCAAGGAAGGGTCGCTCGAGTTCCTGGAGCACATGCTAGACCTCGCGTTGCTCAACGAC
CGTCCGGTGGCGCTGTACGCCGACTTCGCGCGGACCCTGGAGATGGCATGGGCTTGGATCTGCGACGACGGCAGC
TCGCCTGCCGGGCAGCGGCTCAAGAGCAAGCTCCTGGGCTCTAGCCTGCCTCTGGCGTCACGGGGCGCCGACGGA
GACGAGGCGGCGGTGCGGCAGGATCAGATGGAGTATGTCTTCGAGGAATGGGTGCATCTCTGCAACAACCAAAAC
GCGTCGGCCAAGGCCACGACCTTTTTCATGCAACAGCTGCAAGCGAAGCAGATTATCCGCGGCCGAGACGACTTG
TTCGTCTTCGTGCGGATCGCTCTCGACCTGGTCGTGGACCGGTTCGACCACATGCCGCTGCAATCGAGGGCCGTG
GCCGAGCCCAAATACATGATGGTGGACGCCCTGGCCAAGCTCATCACCATCTTCGTGACGATGCACAACGAAGAC
TCGACGTCGCGAACGGCGTTCCTCGACTCGGTGCTGGTGCTTCTCGGACTGGTGCTCAGCCACCACCACATGGAG
CGGCCAGAGCACCTGAACCAGCGCGTCTTCTTCCGCCTTTTCTCCATGATACTCCACGAGATGCAGAACGCATCG
GAGGAGTTCACGGAGGAGGAGCAGCAACAGATGATGCTGAGGTTCGCAAAGAGGTTCCAGTCGATCGGGCCGCTG
CGCCTCCCCGGCTTCGCCTTTAGCTGGCTCGGCCTGATCCAGCACAGGGCCTTTCTGCCACTGCTGATGCAAGTA
CCGGGGGGTTCCGGATGGGAACCGTGCGTGAATCTGATGGTGCAGCTTCTCAACTGTCTCGGCGAGCAGCTGAAG
ACGTTTACCGTGTCGCCCGTGACCAAGGAGCTCTATCGTGCGACGCTCAAGTTTCTTATCGTCCTGCAGCACGAC
TATCCTGACTTTCTGGCGGCGAGCCACATGAAGCTCTGCGCTCACATTCCGGCGCACTGCACGCAGCTGCTCAAC
ACGATACTCGCAGCTAACCCGCAGCAGCACTACGGCAAGCTGCCGGACCCCATGTACCCGGGGCTCAAGGTGGAC
CGGATGGAGGACATGAAGACGCACCCCGGGCTGATGGTGGAAGCGGTGGCGACGCTGCGAGAGTGCGGGCTCCTG
GGTGTACTCGACCACGTGCTGCAGAGCGGGCCGACGGAGGACGCGGTAGCGCAGATGGCACATGCCATGACACAC
AAGGTGCCCGAGGACACGGCCTTTGGCCATGTGGCCGTGGCGGCCAACGCCGAGGTGATTGGGGCCGTGGTGATT
TACACTGGACAGCATGCTGCCGGTCGAGCGACGTCGACGTCGAGCGCCATCCCGGTGAACAGCGGCGAGTCTGAC
GTGTCGGTCATGTCGCTGCTGGTGCACGAGCTCCCGCCCGAGGCCAGATACTACCTCTTGTCTAGCATGGCCAAC
CAGCTACGATACCCCTGCGCCCACACCGAGTACTTCAGCCAGCTCATCCTGTACATGTTCGGAAAGGACCTCAAC
GACCCGGAGGAGTCAGATATTCGACAGGAGATTGCGCGCGTGCTGCTGGAGCGACTTGTCGGCTTCTGGCCCCAG
CCATGGGGACTCATGTTCACGGTGCTCGAACTTGTCAAGAACGACAAGTACATGTTCTTTGAACTGCCCTTTGTC
AAATCCACACCAGAGGTGGCCGATAGGTTTGCTGCCGTTCTGCAACGGGCC
Transcript >Ophio5|4647
ATGGTGCCTCCACCACGAGCGGGATCCTTTTCGCCAAATCCTGCACAGACTCTTCAAACGGGCACCGGGCACTCG
CCGCACCCCTCTCACGCTGGCGTCCTGAGTGCTGGCGCCAGCCCCAGCACCAGCAGCCCGACTGGGACCAACTCT
TTGACCAAGATCGTTGTGGCCCAAGTCTATCTCCTGCTCAGCACCATCAAGGAGGACAAGGACCGTGCCAAGTGG
GAAATCCAGGTGGATCAGTTACGAAAGCTCATCGATGAACACGGCATGGAAGTCTTTTCCAAATACTTCACCCGT
CTAGTAGCGGGCAATGCGCCCCAGATATTCCCTGGCCTCAACAGGCCTGTTGCGAATCCGGGAAATTACCACATT
CTCGCCGCCGAGATGCGCAAAATCGCCCATGACACCGGTCAAGCTGGCAAGATAGCCGAGTCCGTCGAGAGCGGC
ACCGAGGACATCTTTCGCGATTTCGACCTCTCCACCTTTATGGAACATTTCAAGCTCGATGCGCTCGAGAAGACC
CTGTTGGCCCTGGCGTTCAAGACAGGATCGCGGTCCGACCTCAAGACCAAAGCCGATGCCATTTTGTCGACCAAT
TTTCCGTCCTTCATGGACATCATATCGCGCCCCGACATCGAGGCTCATGCGGACCTAACGCCGGCCTTTGTAGCC
TTTATCGTCGATCGATTCCTCCAATATCATCCTCCTAGCTTTAACGTTTCGTCCAGACGGGATCTACACAACTAC
GTCGTTAAGCGTTACGTCAGTATGGATCAGCCGCCTCCTTCCCAGGTTCTTTCCGCCCTCGATGTCGGCAGAGTC
CTCGCCGACAGGCCGGCAAACGTCTTGGCCCGATATATTCAGAGGACCGGTGCCGATTTCACTCGCGACGAGGAG
ACGTGCTTCTCGTACTTGCAAGGCCGCCCAAACAGCATGCAGCTCAGTCCCGATCAGGTGTCGGCGGCACTCATC
TTTACAACAATCACCCAGAGCCCCCACCACGACCCGTCGGTGCTCACAGCTGCCCTGCAGCGCGTACTCCCCAAG
TCATTTGAGTGGAACGAGGTCATCATGTTCTTTGACCAGCCGTCGGCCCGCATCTCGTCGTCTCAGTTCCTGCGT
CTCTACAAGGCTTTGCTGCCCATCGCTCAGGACCCAAAGCGCAACTTGGACATTCAGCGGCTGTGGGGCGGCTCG
TGGAGCGAGCCCGAGGCTCAGCTCTCCTTCGTCAGTGCGTACGGGTCGTTGACACCAGATCAGCTCGACGCGACG
ACGATCCCGCGCTTGCACCGAAGCATCAACATTGACGAATACGCCAACGCTTCGCCGAGCGTGCAAGAGCGGGCC
GCGGTGGCCGTCAAGCATCCTCTGGTCTCCGTCGCTGCCCTCTCCGCCATTTTCAATGTTGCCCTCAACTCGGTC
CATGCTTCGCAGAGCGTCGAGGCTAAACGGCTGTTTCAGGAAGTGGTGGTGCCCAACCTCGACATCTTCTTGGTG
TCTGCCTTTGAGGTTCCGCGACAATCCTGGGCGTCAATGGCAGTCGACACACTGAACTCGCTCTTCGAGAACTTC
CTGTACAAACGGTCCCCCGAGTACGACTTTGTGTTCGACAGCCTTTGGAAGAAGGACCGCGAGTGGGTTGTTCAG
CGGCTCATTGACGCTCACGCCGTGAAGCCCATCGATCTGCCTTTGGTCTATGAGCATGCCGTTAAACTGGGTTGG
CTTGATGACTTGGTCTATCTTCCCAATGGCTTCGGCATCGATCTCGCCGCCTACGCGCACGCCCAGGGCCATCTT
GATCTGGCAAATTGGGCGCGTTTCAACGCAGACAGAAGCGCGGAGATTGCGCGCACCCTGCTACAGTTTTTGATG
ATCAAGGCCAACCTGGAGATTCAGTTCCAGCGGCCGCCCGACGGTCAGGCCGCGGTGAAGACGAGCACCAGCTTG
CAGGTCCGGACCGTCTCTGCCTTGCTGCAAATACTGGAAGACTTCCTGCCTGGAGCGCCGGTCCAAGATCTGATC
CTCGTACAACGCCACTGCATCACAGCATACCCCCGACTCATCAACTACGGCGAAGGCTACGACGACGTCATCGAT
GCGAATGGCAGGGACGGCAACGCCTTGCCGCAAGCCGCCAACAGCAAAATGGAAGAGCACTACAAGAAGATGTAC
GGCGACGAACTTCAGGTTCGCACCATCGTGGAGATTCTGGACCGCTACAAGCGCTCACGGGAGCCCCTGGATCAG
GACGCCTTCGCCTGCATGATCCACGGTCTCTTTGACGAGTACAATCACTACGTCGACTACCCCCTGGAGGCTCTG
GCCACGACGGCAGTCCTTTTTGGCGGGATAATATCCCACAAGTTGATTGCAGAACTCCCCCTGCAAATCGGTCTC
GGCATGATCCTCGAAGCGGTCAGGGATCACATGCCCGATGACCCCATGTACAAGTTTGGCCTCCAGGCCTTGATG
CAGCTCCTGGTCCGCTTCAGGGAATGGCCCGGCTTCTGCGAGCAACTGCTGCAGATCCCCGGCTTGCAAGGCACG
GAAGCTTATAAAAAGGCCGAGGAGATTGTCAGGGACCACGAGAAGGAGGTGGTGCGCTCGCGCAACGGCGCCGGC
ACGCCGCGCGGTCTTAACTTCGCCGGCGACTCTTTCGTCAACGGCAACACCGACGAGCCCGTGGCCAGCGATCGC
CAAGCTCCTCCGTTCGCGGCCATCGGAGTCGAGGCTGTCCCCGTCGGCGCTGATTCTGAACAGCCCGGTGACGAG
GAGCAGGGCAAGATTCAGTTCGTTCTCAATAACATTACCGAGGGAACCCTACAGTCGATGCGCAATGAGCTGCGC
GAGATGCTGGAACGCAAGCACCAACAATGGTTCGCCAGCCATCTCGTCGAAGAGCGCGCCAAAATGCAGCCCAAC
TACCACCACGTCTACCTGGAGCTTGTGAAGCTCTTCGAGGACAACGCCCTGTGGCACGAGGTCCTCCGCGAAACC
TTCATCAGCGTTGCCCGGATGCTCAACTCGGAGCTCACATTGCAGAACTCGACGGAAAGGACCCATCTTAAGAAT
CTCGGAGGCTGGCTCGGCCTCCTAACTCTGGCGCGGGACAAGCCGATCAAGCACAAGAACATCGCCTTCAAGCAG
TTGTTGATCGAGGCACACGATACTAAGAGGCTCATTGTCGTCATACCCTTCGTGTGCAAGGTCCTGATCCAAGGC
GCCACGTCGCAAGTGTTCCGGCCCCCGAACCCCTGGCTCATGGACATAATACATCTCCTCATCGAGCTGTACCAT
CATGCCGAACTCAAATTGAACCTCAAATTCGAGATCGAGGTCCTCTGCAAGGGGCTGAACCTCGACCACAAGAGC
ATCGAACCGTCGGGAGAGATCCTGAACCGCCCCTCGGCGGACGAGGCAGCCGAGGTGCTGCCCCAAGACCAGCCG
GATGCCTTCGAAAACCTGCCACTGAATGGCATCGGCTCTGTCGTCGGCTCGGGCCTGTCTCCGCAGGCCGTCGCG
CCCACCATCCCCGACGTCGGCCCCCTGATCACGATTCCGCCGACAAACGAGATGGTAGTCAGCACCACGCGCCTG
CACGAGATTGTCGAGGCCGCCTTGACCCGGGCTCTGCAAGACATCATCCAGCCTGTCGTCGATAGGTCCATAACG
ATTGCTTCGATATCTACTGTGCAGATGATACGCAAGGATTTCGTATCGGAGCCCGACGAGAACCGCCTGCGGACG
TCGGCCGTGAACATGGTCAAAGCGACTGCGGGCAGCCTGGCCCTTGTCACGTCCAAGGAACCCTTGCGCGCAAAC
ATGACGAATTATATGCGAAGCCTCGCCAACGACCTACCTTCGGGCCTTCCGGAAGGGACCATCATCATGTGCGTC
AACTCGAACCTCGACCTGGCGTGCAGCATCATCGAGAAGCAGGCCGAGGAGAGGGCAGTGCCGGATATCGAAGAG
CTTCTGGAGGAAGACACGGCAACGAGGAGGCTCCATCGTATCCAGCAGCCAAACGAGCCCTTCTACTCGGGCAAC
GTCAACCGTTGGGGAATGACAATCCCAAATCCGTACAAGCTGTCGCCCAACCTGAACGGTCTCAACCCGGAGCAG
ATGGCGATATACGAGGACTTTGCCCGACAGCCGCGAAACGCCACGACGTCGGGACCTTCGCATGCACCCTCGACG
TCAGACGCCACTCGATCCCTGGCCAACGAGGTGCTGCAGGAATCCTACAACGCCGTGCCCGCCCTCCCAACACCG
GCCGAGACGCCTTCGATGCCGCACATGGGACCCCAACTGCAACCATACGGTCCGGTTCATGCGGCCACCAACACG
ATGGCGGGCGGGCGGGCGGCCAGCTTCCAGATGGACGTGCGTGGCCTGGCTGATCGGGTGAACAAGCTGCTTCAG
GAGCTCATGCGCGTCTCGGGCGAGGCTCGCGAAGAGCATTTTGCGGGCCTCCCGAGACCGCATTCCGTCCTCGAT
GTGGTCGACGCCCTGGTGCAGCTCATCATCAAGACGTCGCAAAGCTCCGAGGAGTTTGTCATATACGCCGCGGAG
CAGATCAGCAACCTCATCTTCCAACAGGTGGACGACAACCTGGCCCTGGAAAGCCTGGTGCACGTGCTCGAGACT
CTGAGGAAGATTTCCGGTCCGGCGCTCAACAACCGCGTCCGGTCCATCTTCTGCCAGCAGCCCGGCGCCACGTTT
CTCAGTATACCTCTCCTGGAGGCGCTGGCAAGGACCGACCTCGTGGAGTGGCGAAATCTGGACCTGGCCATGTCC
CAGGTAGTCGAAGGCCGCAAGGAAGGGTCGCTCGAGTTCCTGGAGCACATGCTAGACCTCGCGTTGCTCAACGAC
CGTCCGGTGGCGCTGTACGCCGACTTCGCGCGGACCCTGGAGATGGCATGGGCTTGGATCTGCGACGACGGCAGC
TCGCCTGCCGGGCAGCGGCTCAAGAGCAAGCTCCTGGGCTCTAGCCTGCCTCTGGCGTCACGGGGCGCCGACGGA
GACGAGGCGGCGGTGCGGCAGGATCAGATGGAGTATGTCTTCGAGGAATGGGTGCATCTCTGCAACAACCAAAAC
GCGTCGGCCAAGGCCACGACCTTTTTCATGCAACAGCTGCAAGCGAAGCAGATTATCCGCGGCCGAGACGACTTG
TTCGTCTTCGTGCGGATCGCTCTCGACCTGGTCGTGGACCGGTTCGACCACATGCCGCTGCAATCGAGGGCCGTG
GCCGAGCCCAAATACATGATGGTGGACGCCCTGGCCAAGCTCATCACCATCTTCGTGACGATGCACAACGAAGAC
TCGACGTCGCGAACGGCGTTCCTCGACTCGGTGCTGGTGCTTCTCGGACTGGTGCTCAGCCACCACCACATGGAG
CGGCCAGAGCACCTGAACCAGCGCGTCTTCTTCCGCCTTTTCTCCATGATACTCCACGAGATGCAGAACGCATCG
GAGGAGTTCACGGAGGAGGAGCAGCAACAGATGATGCTGAGGTTCGCAAAGAGGTTCCAGTCGATCGGGCCGCTG
CGCCTCCCCGGCTTCGCCTTTAGCTGGCTCGGCCTGATCCAGCACAGGGCCTTTCTGCCACTGCTGATGCAAGTA
CCGGGGGGTTCCGGATGGGAACCGTGCGTGAATCTGATGGTGCAGCTTCTCAACTGTCTCGGCGAGCAGCTGAAG
ACGTTTACCGTGTCGCCCGTGACCAAGGAGCTCTATCGTGCGACGCTCAAGTTTCTTATCGTCCTGCAGCACGAC
TATCCTGACTTTCTGGCGGCGAGCCACATGAAGCTCTGCGCTCACATTCCGGCGCACTGCACGCAGCTGCTCAAC
ACGATACTCGCAGCTAACCCGCAGCAGCACTACGGCAAGCTGCCGGACCCCATGTACCCGGGGCTCAAGGTGGAC
CGGATGGAGGACATGAAGACGCACCCCGGGCTGATGGTGGAAGCGGTGGCGACGCTGCGAGAGTGCGGGCTCCTG
GGTGTACTCGACCACGTGCTGCAGAGCGGGCCGACGGAGGACGCGGTAGCGCAGATGGCACATGCCATGACACAC
AAGGTGCCCGAGGACACGGCCTTTGGCCATGTGGCCGTGGCGGCCAACGCCGAGGTGATTGGGGCCGTGGTGATT
TACACTGGACAGCATGCTGCCGGTCGAGCGACGTCGACGTCGAGCGCCATCCCGGTGAACAGCGGCGAGTCTGAC
GTGTCGGTCATGTCGCTGCTGGTGCACGAGCTCCCGCCCGAGGCCAGATACTACCTCTTGTCTAGCATGGCCAAC
CAGCTACGATACCCCTGCGCCCACACCGAGTACTTCAGCCAGCTCATCCTGTACATGTTCGGAAAGGACCTCAAC
GACCCGGAGGAGTCAGATATTCGACAGGAGATTGCGCGCGTGCTGCTGGAGCGACTTGTCGGCTTCTGGCCCCAG
CCATGGGGACTCATGTTCACGGTGCTCGAACTTGTCAAGAACGACAAGTACATGTTCTTTGAACTGCCCTTTGTC
AAATCCACACCAGAGGTGGCCGATAGGTTTGCTGCCGTTCTGCAACGGGCCTAG
Gene >Ophio5|4647
ATGGTGCCTCCACCACGAGCGGGATCCTTTTCGCCAAATCCTGCACAGACTCTTCAAACGGGCACCGGGCACTCG
CCGCACCCCTCTCACGCTGGCGTCCTGAGTGCTGGCGCCAGCCCCAGCACCAGCAGCCCGACTGGGACCAACTCT
TTGACCAAGATCGTTGTGGCCCAAGTCTATCTCCTGCTCAGCACCATCAAGGAGGACAAGGACCGTGCCAAGTGG
GAAATCCAGGTGGATCAGTTACGAAAGGTGAGTCTCGCTTGCTAGTACCGGTCAGCGCCACGGCTTCCCTAACCT
CGTTCAAGCTCATCGATGAACACGGCATGGAAGTCTTTTCCAAATACTTCACCCGTCTAGTAGCGGGCAATGCGC
CCCAGATATTCCCTGGCCTCAACAGGCCTGTTGCGAATCCGGGAAATTACCACATTCTCGCCGCCGAGATGCGCA
AAATCGCCCATGACACCGGTCAAGCTGGCAAGATAGCCGAGTCCGTCGAGAGCGGCACCGAGGACATCTTTCGCG
ATTTCGACCTCTCCACCTTTATGGAACATTTCAAGCTCGATGCGCTCGAGAAGACCCTGTTGGCCCTGGCGTTCA
AGACAGGATCGCGGTCCGACCTCAAGACCAAAGGTAGGTATCTGATGCTGCAACCCGTACTCGATAGCCTGGCTG
ACACGTCATCTGCAGCCGATGCCATTTTGTCGACCAATTTTCCGTCCTTCATGGACATCATATCGCGCCCCGACA
TCGAGGCTCATGCGGACCTAACGCCGGCCTTTGTAGCCTTTATCGTCGATCGATTCCTCCAATATCATCCTCCTA
GCTTTAACGTTTCGTCCAGACGGGATCTACACAACTACGTCGTTAAGCGTTACGTCAGTATGGATCAGCCGCCTC
CTTCCCAGGTTCTTTCCGCCCTCGATGTCGGCAGAGTCCTCGCCGACAGGCCGGCAAACGTCTTGGCCCGATATA
TTCAGAGGACCGGTGCCGATTTCACTCGCGACGAGGAGACGTGCTTCTCGTACTTGCAAGGCCGCCCAAACAGCA
TGCAGCTCAGTCCCGATCAGGTGTCGGCGGCACTCATCTTTACAACAATCACCCAGAGCCCCCACCACGACCCGT
CGGTGCTCACAGCTGCCCTGCAGCGCGTACTCCCCAAGTCATTTGAGTGGAACGAGGTCATCATGTTCTTTGACC
AGCCGTCGGCCCGCATCTCGTCGTCTCAGTTCCTGCGTCTCTACAAGGCTTTGCTGCCCATCGCTCAGGACCCAA
AGCGCAACTTGGACATTCAGCGGCTGTGGGGCGGCTCGTGGAGCGAGCCCGAGGCTCAGCTCTCCTTCGTCAGTG
CGTACGGGTCGTTGACACCAGATCAGCTCGACGCGACGACGATCCCGCGCTTGCACCGAAGCATCAACATTGACG
AATACGCCAACGCTTCGCCGAGCGTGCAAGAGCGGGCCGCGGTGGCCGTCAAGCATCCTCTGGTCTCCGTCGCTG
CCCTCTCCGCCATTTTCAATGTTGCCCTCAACTCGGTCCATGCTTCGCAGAGCGTCGAGGCTAAACGGCTGTTTC
AGGAAGTGGTGGTGCCCAACCTCGACATCTTCTTGGTGTCTGCCTTTGAGGTTCCGCGACAATCCTGGGCGTCAA
TGGCAGTCGACACACTGAACTCGCTCTTCGAGAACTTCCTGTACAAACGGTCCCCCGAGTACGACTTTGTGTTCG
ACAGCCTTTGGAAGAAGGACCGCGAGTGGGTTGTTCAGCGGCTCATTGACGCTCACGCCGTGAAGCCCATCGATC
TGCCTTTGGTCTATGAGCATGCCGTTAAACTGGGTTGGCTTGATGACTTGGTCTATCTTCCCAATGGCTTCGGCA
TCGATCTCGCCGCCTACGCGCACGCCCAGGGCCATCTTGATCTGGCAAATTGGGCGCGTTTCAACGCAGACAGAA
GCGCGGAGATTGCGCGCACCCTGCTACAGTTTTTGATGATCAAGGCCAACCTGGAGATTCAGTTCCAGCGGCCGC
CCGACGGTCAGGCCGCGGTGAAGACGAGCACCAGCTTGCAGGTCCGGACCGTCTCTGCCTTGCTGCAAATACTGG
AAGACTTCCTGCCTGGAGCGCCGGTCCAAGATCTGATCCTCGTACAACGCCACTGCATCACAGCATACCCCCGAC
TCATCAACTACGGCGAAGGCTACGACGACGTCATCGATGCGAATGGCAGGGACGGCAACGCCTTGCCGCAAGCCG
CCAACAGCAAAATGGAAGAGCACTACAAGAAGATGTACGGCGACGAACTTCAGGTTCGCACCATCGTGGAGATTC
TGGACCGCTACAAGCGCTCACGGGAGCCCCTGGATCAGGACGCCTTCGCCTGCATGATCCACGGTCTCTTTGACG
AGTACAATCACTACGTCGACTACCCCCTGGAGGCTCTGGCCACGACGGCAGTCCTTTTTGGCGGGATAATATCCC
ACAAGTTGATTGCAGAACTCCCCCTGCAAATCGGTCTCGGCATGATCCTCGAAGCGGTCAGGGATCACATGCCCG
ATGACCCCATGTACAAGTTTGGCCTCCAGGCCTTGATGCAGCTCCTGGTCCGCTTCAGGGAATGGCCCGGCTTCT
GCGAGCAACTGCTGCAGATCCCCGGCTTGCAAGGCACGGAAGCTTATAAAAAGGCCGAGGAGATTGTCAGGGACC
ACGAGAAGGAGGTGGTGCGCTCGCGCAACGGCGCCGGCACGCCGCGCGGTCTTAACTTCGCCGGCGACTCTTTCG
TCAACGGCAACACCGACGAGCCCGTGGCCAGCGATCGCCAAGCTCCTCCGTTCGCGGCCATCGGAGTCGAGGCTG
TCCCCGTCGGCGCTGATTCTGAACAGCCCGGTGACGAGGAGCAGGGCAAGATTCAGTTCGTTCTCAATAACATTA
CCGAGGGAACCCTACAGTCGATGCGCAATGAGCTGCGCGAGATGCTGGAACGCAAGCACCAACAATGGTTCGCCA
GCCATCTCGTCGAAGAGCGCGCCAAAATGCAGCCCAACTACCACCACGTCTACCTGGAGCTTGTGAAGCTCTTCG
AGGACAACGCCCTGTGGCACGAGGTCCTCCGCGAAACCTTCATCAGCGTTGCCCGGATGCTCAACTCGGAGCTCA
CATTGCAGAACTCGACGGAAAGGACCCATCTTAAGAATCTCGGAGGCTGGCTCGGCCTCCTAACTCTGGCGCGGG
ACAAGCCGATCAAGCACAAGAACATCGCCTTCAAGCAGTTGTTGATCGAGGCACACGATACTAAGAGGCTCATTG
TCGTCATACCCTTCGTGTGCAAGGTCCTGATCCAAGGCGCCACGTCGCAAGTGTTCCGGCCCCCGAACCCCTGGC
TCATGGACATAATACATCTCCTCATCGAGCTGTACCATCATGCCGAACTCAAATTGAACCTCAAATTCGAGATCG
AGGTCCTCTGCAAGGGGCTGAACCTCGACCACAAGAGCATCGAACCGTCGGGAGAGATCCTGAACCGCCCCTCGG
CGGACGAGGCAGCCGAGGTGCTGCCCCAAGACCAGCCGGATGCCTTCGAAAACCTGCCACTGAATGGCATCGGCT
CTGTCGTCGGCTCGGGCCTGTCTCCGCAGGCCGTCGCGCCCACCATCCCCGACGTCGGCCCCCTGATCACGATTC
CGCCGACAAACGAGATGGTAGTCAGCACCACGCGCCTGCACGAGATTGTCGAGGCCGCCTTGACCCGGGCTCTGC
AAGACATCATCCAGCCTGTCGTCGATAGGTCCATAACGATTGCTTCGATATCTACTGTGCAGATGATACGCAAGG
ATTTCGTATCGGAGCCCGACGAGAACCGCCTGCGGACGTCGGCCGTGAACATGGTCAAAGCGACTGCGGGCAGCC
TGGCCCTTGTCACGTCCAAGGAACCCTTGCGCGCAAACATGACGAATTATATGCGAAGCCTCGCCAACGACCTAC
CTTCGGGCCTTCCGGAAGGGACCATCATCATGTGCGTCAACTCGAACCTCGACCTGGCGTGCAGCATCATCGAGA
AGCAGGCCGAGGAGAGGGCAGTGCCGGATATCGAAGAGCTTCTGGAGGAAGACACGGCAACGAGGAGGCTCCATC
GTATCCAGCAGCCAAACGAGCCCTTCTACTCGGGCAACGTCAACCGTTGGGGAATGACAATCCCAAATCCGTACA
AGCTGTCGCCCAACCTGAACGGTCTCAACCCGGAGCAGATGGCGATATACGAGGACTTTGCCCGACAGCCGCGAA
ACGCCACGACGTCGGGACCTTCGCATGCACCCTCGACGTCAGACGCCACTCGATCCCTGGCCAACGAGGTGCTGC
AGGAATCCTACAACGCCGTGCCCGCCCTCCCAACACCGGCCGAGACGCCTTCGATGCCGCACATGGGACCCCAAC
TGCAACCATACGGTCCGGTTCATGCGGCCACCAACACGATGGCGGGCGGGCGGGCGGCCAGCTTCCAGATGGACG
TGCGTGGCCTGGCTGATCGGGTGAACAAGCTGCTTCAGGAGCTCATGCGCGTCTCGGGCGAGGCTCGCGAAGAGC
ATTTTGCGGGCCTCCCGAGACCGCATTCCGTCCTCGATGTGGTCGACGCCCTGGTGCAGCTCATCATCAAGACGT
CGCAAAGCTCCGAGGAGTTTGTCATATACGCCGCGGAGCAGATCAGCAACCTCATCTTCCAACAGGTGGACGACA
ACCTGGCCCTGGAAAGCCTGGTGCACGTGCTCGAGACTCTGAGGAAGATTTCCGGTCCGGCGCTCAACAACCGCG
TCCGGTCCATCTTCTGCCAGCAGCCCGGCGCCACGTTTCTCAGTATACCTCTCCTGGAGGCGCTGGCAAGGACCG
ACCTCGTGGAGTGGCGAAATCTGGACCTGGCCATGTCCCAGGTAGTCGAAGGCCGCAAGGAAGGGTCGCTCGAGT
TCCTGGAGCACATGCTAGACCTCGCGTTGCTCAACGACCGTCCGGTGGCGCTGTACGCCGACTTCGCGCGGACCC
TGGAGATGGCATGGGCTTGGATCTGCGACGACGGCAGCTCGCCTGCCGGGCAGCGGCTCAAGAGCAAGCTCCTGG
GCTCTAGCCTGCCTCTGGCGTCACGGGGCGCCGACGGAGACGAGGCGGCGGTGCGGCAGGATCAGATGGAGTATG
TCTTCGAGGAATGGGTGCATCTCTGCAACAACCAAAACGCGTCGGCCAAGGCCACGACCTTTTTCATGCAACAGC
TGCAAGCGAAGCAGATTATCCGCGGCCGAGACGACTTGTTCGTCTTCGTGCGGATCGCTCTCGACCTGGTCGTGG
ACCGGTTCGACCACATGCCGCTGCAATCGAGGGCCGTGGCCGAGCCCAAATACATGATGGTGGACGCCCTGGCCA
AGCTCATCACCATCTTCGTGACGATGCACAACGAAGACTCGACGTCGCGAACGGCGTTCCTCGACTCGGTGCTGG
TGCTTCTCGGACTGGTGCTCAGCCACCACCACATGGAGCGGCCAGAGCACCTGAACCAGCGCGTCTTCTTCCGCC
TTTTCTCCATGATACTCCACGAGATGCAGAACGCATCGGAGGAGTTCACGGAGGAGGAGCAGCAACAGATGATGC
TGAGGTTCGCAAAGAGGTTCCAGTCGATCGGGCCGCTGCGCCTCCCCGGCTTCGCCTTTAGCTGGCTCGGCCTGA
TCCAGCACAGGGCCTTTCTGCCACTGCTGATGCAAGTACCGGGGGGTTCCGGATGGGAACCGTGCGTGAATCTGA
TGGTGCAGCTTCTCAACTGTCTCGGCGAGCAGCTGAAGACGTTTACCGTGTCGCCCGTGACCAAGGAGCTCTATC
GTGCGACGCTCAAGTTTCTTATCGTCCTGCAGCACGACTATCCTGACTTTCTGGCGGCGAGCCACATGAAGCTCT
GCGCTCACATTCCGGCGCACTGCACGCAGCTGCTCAACACGATACTCGCAGCTAACCCGCAGCAGCACTACGGCA
AGCTGCCGGACCCCATGTACCCGGGGCTCAAGGTGGACCGGATGGAGGACATGAAGACGCACCCCGGGCTGATGG
TGGAAGCGGTGGCGACGCTGCGAGAGTGCGGGCTCCTGGGTGTACTCGACCACGTGCTGCAGAGCGGGCCGACGG
AGGACGCGGTAGCGCAGATGGCACATGCCATGACACACAAGGTGCCCGAGGACACGGCCTTTGGCCATGTGGCCG
TGGCGGCCAACGCCGAGGTGATTGGGGCCGTGGTGATTTACACTGGACAGCATGCTGCCGGTCGAGCGACGTCGA
CGTCGAGCGCCATCCCGGTGAACAGCGGCGAGTCTGACGTGTCGGTCATGTCGCTGCTGGTGCACGAGCTCCCGC
CCGAGGCCAGATACTACCTCTTGTCTAGCATGGCCAACCAGCTACGATACCCCTGCGCCCACACCGAGTACTTCA
GCCAGCTCATCCTGTACATGTTCGGAAAGGACCTCAACGACCCGGAGGAGTCAGATATTCGACAGGAGATTGCGC
GCGTGCTGCTGGAGCGACTTGTCGGCTTCTGGCCCCAGCCATGGGGACTCATGTTCACGGTGCTCGAACTTGTCA
AGAACGACAAGTACATGTTCTTTGAACTGCCCTTTGTCAAATCCACACCAGAGGTAGGCTCCGCTCCGCTCCTGG
CGGGCCAAGGACGCAACAACTGACTTGTGCAGGTGGCCGATAGGTTTGCTGCCGTTCTGCAACGGGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail