Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4645
Gene name
Locationscaffold_37:54757..56040
Strand-
Gene length (bp)1283
Transcript length (bp)1155
Coding sequence length (bp)1152
Protein length (aa) 384

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06775 Seipin Putative adipose-regulatory protein (Seipin) 1.7E-57 32 246

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14119|BSCLH_SCHPO Seipin homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3A11.04 PE=3 SV=4 30 273 8.0E-14
sp|Q9V3X4|BSCL2_DROME Seipin OS=Drosophila melanogaster GN=Seipin PE=2 SV=1 16 261 7.0E-08

GO

GO Term Description Terminal node
GO:0019915 lipid storage Yes
GO:0051179 localization No
GO:0051235 maintenance of location No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22
2 242 264 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 67.74 36.93 98.55
CcL In ants, during behavior modification 67.64 32.71 102.58
CcD In ants, recently dead 53.81 28.69 78.92

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.995833 no
SC16a CcD 0.333659 no
CcL CcD 0.380095 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4645
MNNIQETVRVATSKPVQRAAVNTALVVSGAVTLFCLAAIATGVFFHNYVPHQLVKIPVHLQYGSGPNPYAVLSLT
RPPMIKTQQEYDVSVLLSMPRSPANVERGNFMVSLHLLEAEASSKLEADARVFAHAHDHFGINKVLFASRRPALV
PYDDPIVSVSKRLLLLLYHMIFPGTQTCTMRVHLAERLAFSKSLDVPASAYVEVEAGQDIQIYQAALIMTAQMRG
LRWLMVHHRLPTYIASTLVFWACEMLFMSLAWIIWAVVTGSRGTRATKGGRPQTSGDTKGERDHDESSEHAYAFP
TVGKQRPLKYEPDVKVEDDERRGRSLADVPVAGTEGDDEEERNVDEDSRGRRRYDSGLGTSYSEKGSGSGSGNVR
RRASRNAME
Coding >Ophio5|4645
ATGAACAACATACAGGAAACTGTGCGCGTCGCGACGTCCAAGCCCGTACAGAGGGCCGCCGTCAACACGGCGCTC
GTCGTGTCCGGGGCCGTTACGCTCTTCTGTCTGGCCGCCATTGCGACGGGCGTCTTCTTTCACAACTACGTGCCG
CATCAACTGGTGAAGATACCTGTGCATCTTCAGTATGGGTCAGGTCCCAATCCGTACGCCGTCCTGTCCCTGACG
CGACCGCCGATGATCAAGACGCAGCAGGAGTACGACGTGTCGGTGCTCCTTTCCATGCCGCGATCCCCGGCCAAC
GTCGAGCGCGGAAACTTTATGGTCTCTTTGCATCTGCTCGAGGCCGAGGCCAGCTCGAAACTCGAAGCCGATGCC
CGTGTATTTGCGCATGCACACGATCACTTTGGCATCAACAAGGTTCTCTTCGCCTCTCGGCGTCCCGCACTCGTG
CCTTACGACGACCCCATCGTCTCCGTGTCCAAGCGCTTGCTCCTCCTGCTGTATCACATGATCTTCCCCGGCACG
CAGACCTGCACCATGAGGGTGCACTTGGCTGAACGGCTCGCCTTTTCTAAGAGTTTGGACGTGCCCGCGTCGGCC
TATGTGGAGGTCGAAGCCGGGCAGGACATACAGATCTACCAAGCGGCTCTGATCATGACGGCGCAGATGCGGGGA
CTGCGATGGCTCATGGTCCACCACCGGCTGCCTACCTACATCGCGTCCACTCTGGTTTTCTGGGCTTGTGAGATG
TTATTCATGAGCCTTGCTTGGATCATTTGGGCTGTCGTGACCGGATCCCGGGGTACTCGGGCAACCAAGGGCGGC
CGCCCCCAGACCAGTGGCGACACCAAGGGCGAGCGAGATCATGACGAATCGTCAGAACATGCGTATGCATTCCCC
ACGGTTGGGAAGCAGCGGCCATTGAAGTATGAGCCGGATGTCAAAGTTGAGGACGACGAGAGGCGAGGTCGGTCC
TTGGCCGATGTGCCCGTCGCTGGGACCGAGGGTGACGACGAGGAGGAACGCAACGTGGACGAGGACAGTCGTGGT
AGGCGCAGATACGACTCTGGCCTGGGCACGAGCTACAGTGAAAAGGGCAGTGGCAGCGGCAGCGGCAACGTGCGC
AGGAGGGCGTCACGAAATGCCATGGAG
Transcript >Ophio5|4645
ATGAACAACATACAGGAAACTGTGCGCGTCGCGACGTCCAAGCCCGTACAGAGGGCCGCCGTCAACACGGCGCTC
GTCGTGTCCGGGGCCGTTACGCTCTTCTGTCTGGCCGCCATTGCGACGGGCGTCTTCTTTCACAACTACGTGCCG
CATCAACTGGTGAAGATACCTGTGCATCTTCAGTATGGGTCAGGTCCCAATCCGTACGCCGTCCTGTCCCTGACG
CGACCGCCGATGATCAAGACGCAGCAGGAGTACGACGTGTCGGTGCTCCTTTCCATGCCGCGATCCCCGGCCAAC
GTCGAGCGCGGAAACTTTATGGTCTCTTTGCATCTGCTCGAGGCCGAGGCCAGCTCGAAACTCGAAGCCGATGCC
CGTGTATTTGCGCATGCACACGATCACTTTGGCATCAACAAGGTTCTCTTCGCCTCTCGGCGTCCCGCACTCGTG
CCTTACGACGACCCCATCGTCTCCGTGTCCAAGCGCTTGCTCCTCCTGCTGTATCACATGATCTTCCCCGGCACG
CAGACCTGCACCATGAGGGTGCACTTGGCTGAACGGCTCGCCTTTTCTAAGAGTTTGGACGTGCCCGCGTCGGCC
TATGTGGAGGTCGAAGCCGGGCAGGACATACAGATCTACCAAGCGGCTCTGATCATGACGGCGCAGATGCGGGGA
CTGCGATGGCTCATGGTCCACCACCGGCTGCCTACCTACATCGCGTCCACTCTGGTTTTCTGGGCTTGTGAGATG
TTATTCATGAGCCTTGCTTGGATCATTTGGGCTGTCGTGACCGGATCCCGGGGTACTCGGGCAACCAAGGGCGGC
CGCCCCCAGACCAGTGGCGACACCAAGGGCGAGCGAGATCATGACGAATCGTCAGAACATGCGTATGCATTCCCC
ACGGTTGGGAAGCAGCGGCCATTGAAGTATGAGCCGGATGTCAAAGTTGAGGACGACGAGAGGCGAGGTCGGTCC
TTGGCCGATGTGCCCGTCGCTGGGACCGAGGGTGACGACGAGGAGGAACGCAACGTGGACGAGGACAGTCGTGGT
AGGCGCAGATACGACTCTGGCCTGGGCACGAGCTACAGTGAAAAGGGCAGTGGCAGCGGCAGCGGCAACGTGCGC
AGGAGGGCGTCACGAAATGCCATGGAGTGA
Gene >Ophio5|4645
ATGGTAAGCAGCCTATCTCTTGCGCTTCGACTCTCTGTCGATTTGAGCTTACGCACTATCGTGACAGAACAACAT
ACAGGAAACTGTGCGCGTCGCGACGTCCAAGCCCGTACAGAGGGCCGCCGTCAACACGGCGCTCGTCGTGTCCGG
GGCCGTTACGCTCTTCTGTCTGGCCGCCATTGCGACGGGCGTCTTCTTTCACAACTACGTGCCGCATCAACTGGT
GAAGATACCTGTGCATCTTCAGTATGGGTGCGTTGGACGAGTCGCTGCCGGCCCTTCCTCTATTCTCGAGCTGAT
GAGCCGCGTCTACCAGGTCAGGTCCCAATCCGTACGCCGTCCTGTCCCTGACGCGACCGCCGATGATCAAGACGC
AGCAGGAGTACGACGTGTCGGTGCTCCTTTCCATGCCGCGATCCCCGGCCAACGTCGAGCGCGGAAACTTTATGG
TCTCTTTGCATCTGCTCGAGGCCGAGGCCAGCTCGAAACTCGAAGCCGATGCCCGTGTATTTGCGCATGCACACG
ATCACTTTGGCATCAACAAGGTTCTCTTCGCCTCTCGGCGTCCCGCACTCGTGCCTTACGACGACCCCATCGTCT
CCGTGTCCAAGCGCTTGCTCCTCCTGCTGTATCACATGATCTTCCCCGGCACGCAGACCTGCACCATGAGGGTGC
ACTTGGCTGAACGGCTCGCCTTTTCTAAGAGTTTGGACGTGCCCGCGTCGGCCTATGTGGAGGTCGAAGCCGGGC
AGGACATACAGATCTACCAAGCGGCTCTGATCATGACGGCGCAGATGCGGGGACTGCGATGGCTCATGGTCCACC
ACCGGCTGCCTACCTACATCGCGTCCACTCTGGTTTTCTGGGCTTGTGAGATGTTATTCATGAGCCTTGCTTGGA
TCATTTGGGCTGTCGTGACCGGATCCCGGGGTACTCGGGCAACCAAGGGCGGCCGCCCCCAGACCAGTGGCGACA
CCAAGGGCGAGCGAGATCATGACGAATCGTCAGAACATGCGTATGCATTCCCCACGGTTGGGAAGCAGCGGCCAT
TGAAGTATGAGCCGGATGTCAAAGTTGAGGACGACGAGAGGCGAGGTCGGTCCTTGGCCGATGTGCCCGTCGCTG
GGACCGAGGGTGACGACGAGGAGGAACGCAACGTGGACGAGGACAGTCGTGGTAGGCGCAGATACGACTCTGGCC
TGGGCACGAGCTACAGTGAAAAGGGCAGTGGCAGCGGCAGCGGCAACGTGCGCAGGAGGGCGTCACGAAATGCCA
TGGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail