Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4642
Gene name
Locationscaffold_37:46617..47291
Strand-
Gene length (bp)674
Transcript length (bp)378
Coding sequence length (bp)375
Protein length (aa) 125

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain 2.0E-31 7 121

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87102|NTF2_NEUCR Nuclear transport factor 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ntf2 PE=2 SV=1 3 123 5.0E-46
sp|Q96VN3|NTF2_EMENI Nuclear transport factor 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ntf2 PE=3 SV=1 1 124 8.0E-46
sp|Q8NJ52|NTF2_DAVTA Nuclear transport factor 2 OS=Davidiella tassiana GN=NTF2 PE=1 SV=1 1 124 2.0E-45
sp|Q10100|NTF2_SCHPO Nuclear transport factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ntf2 PE=3 SV=2 1 125 6.0E-42
sp|Q6CQX4|NTF2_KLULA Nuclear transport factor 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NTF2 PE=3 SV=1 3 125 2.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87102|NTF2_NEUCR Nuclear transport factor 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ntf2 PE=2 SV=1 3 123 5.0E-46
sp|Q96VN3|NTF2_EMENI Nuclear transport factor 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ntf2 PE=3 SV=1 1 124 8.0E-46
sp|Q8NJ52|NTF2_DAVTA Nuclear transport factor 2 OS=Davidiella tassiana GN=NTF2 PE=1 SV=1 1 124 2.0E-45
sp|Q10100|NTF2_SCHPO Nuclear transport factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ntf2 PE=3 SV=2 1 125 6.0E-42
sp|Q6CQX4|NTF2_KLULA Nuclear transport factor 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NTF2 PE=3 SV=1 3 125 2.0E-41
sp|Q6FRC6|NTF2_CANGA Nuclear transport factor 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NTF2 PE=3 SV=1 3 125 2.0E-41
sp|Q9P926|NTF2_CANAX Nuclear transport factor 2 OS=Candida albicans GN=NTF2 PE=3 SV=1 3 125 1.0E-40
sp|Q75AA5|NTF2_ASHGO Nuclear transport factor 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NTF2 PE=3 SV=1 3 125 1.0E-40
sp|Q6BWC0|NTF2_DEBHA Nuclear transport factor 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=NTF2 PE=3 SV=1 3 124 3.0E-39
sp|P33331|NTF2_YEAST Nuclear transport factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NTF2 PE=1 SV=2 3 125 5.0E-39
sp|Q6CC82|NTF2_YARLI Nuclear transport factor 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NTF2 PE=3 SV=1 3 122 4.0E-33
sp|Q9XJ54|NTF2_ORYSJ Nuclear transport factor 2 OS=Oryza sativa subsp. japonica GN=NTF2 PE=2 SV=1 5 125 1.0E-31
sp|Q9C7F5|NTF2_ARATH Nuclear transport factor 2 OS=Arabidopsis thaliana GN=NTF2 PE=1 SV=1 5 124 1.0E-29
sp|Q86HW7|NTF2_DICDI Nuclear transport factor 2 OS=Dictyostelium discoideum GN=nutf2 PE=1 SV=1 7 123 1.0E-20
sp|Q21735|NTF2_CAEEL Probable nuclear transport factor 2 OS=Caenorhabditis elegans GN=ran-4 PE=3 SV=1 3 122 2.0E-17
sp|Q5R8G4|NTF2_PONAB Nuclear transport factor 2 OS=Pongo abelii GN=NUTF2 PE=2 SV=1 4 123 3.0E-16
sp|P61972|NTF2_RAT Nuclear transport factor 2 OS=Rattus norvegicus GN=Nutf2 PE=1 SV=1 4 123 3.0E-16
sp|P61971|NTF2_MOUSE Nuclear transport factor 2 OS=Mus musculus GN=Nutf2 PE=1 SV=1 4 123 3.0E-16
sp|P61970|NTF2_HUMAN Nuclear transport factor 2 OS=Homo sapiens GN=NUTF2 PE=1 SV=1 4 123 3.0E-16
sp|Q32KP9|NTF2_BOVIN Nuclear transport factor 2 OS=Bos taurus GN=NUTF2 PE=2 SV=1 4 123 3.0E-16
sp|O42242|NTF2_XENLA Nuclear transport factor 2 OS=Xenopus laevis GN=ntf2 PE=2 SV=1 4 122 6.0E-16
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4642
MSNYEEIAKQFIEIYYNAFDSDRKSLLSLYREQSMLTFESASCCGSNNIVEKLVSLHFANVKHQVATLDAQPSIA
EGGIFIMVTGQLLVDDEQHPMNYTQAFQLARDPSNGQYFVFNDIFKLVYG
Coding >Ophio5|4642
ATGAGTAACTACGAAGAAATCGCGAAGCAATTTATTGAAATCTACTACAATGCCTTTGACTCGGATCGCAAGTCG
CTCCTCTCACTCTACCGTGAACAGTCGATGCTCACCTTCGAGTCCGCCTCGTGCTGTGGATCCAACAACATCGTC
GAGAAGCTGGTGTCCCTACACTTTGCCAATGTCAAGCACCAGGTCGCCACGCTCGACGCACAGCCATCCATCGCG
GAGGGTGGCATCTTCATCATGGTAACAGGCCAGCTGTTGGTCGACGATGAGCAGCACCCCATGAACTACACGCAG
GCTTTCCAGTTGGCGCGCGACCCGTCCAATGGCCAATACTTTGTTTTCAACGACATCTTCAAGCTGGTTTACGGT
Transcript >Ophio5|4642
ATGAGTAACTACGAAGAAATCGCGAAGCAATTTATTGAAATCTACTACAATGCCTTTGACTCGGATCGCAAGTCG
CTCCTCTCACTCTACCGTGAACAGTCGATGCTCACCTTCGAGTCCGCCTCGTGCTGTGGATCCAACAACATCGTC
GAGAAGCTGGTGTCCCTACACTTTGCCAATGTCAAGCACCAGGTCGCCACGCTCGACGCACAGCCATCCATCGCG
GAGGGTGGCATCTTCATCATGGTAACAGGCCAGCTGTTGGTCGACGATGAGCAGCACCCCATGAACTACACGCAG
GCTTTCCAGTTGGCGCGCGACCCGTCCAATGGCCAATACTTTGTTTTCAACGACATCTTCAAGCTGGTTTACGGT
TGA
Gene >Ophio5|4642
ATGAGTAGTAAGCGCATGAGCCCGTCGTGGCGGGAGAGACGGCGGCTAACCATGAGGAAATAGACTACGAAGAAA
TCGCGAGTATGCATTCATCACCTTGACCAGAGTCCGGCGGAAGCACCTCCCTGACGTACGACAGAGCAATTTATT
GAAATCTACTACAATGCCTTTGACTCGGATCGCAAGTCGCTCCTCTCACTCTACGTGCGTGCGCTCTCCACACTC
GTCCATGATTGAGGGCGCCGGCTGACTTGCCCCGCAGCGTGAACAGTCGATGCTCACCTTCGAGTCCGCCTCGTG
CTGTGGATCCAACAACATCGTCGAGAAGCTGGTGGTGCGTGAGCCCAGCTTCTGCAACCGCTCTGGCCTCGGTCT
GGCTGACCTTTCGTCTCGTCACAGTCCCTACACTTTGCCAATGTCAAGCACCAGGTCGCCACGCTCGACGCACAG
CCATCCATCGCGGAGGGTGGCATCTTCATCATGGTAACAGGCCAGCTGTTGGTACGAATGTCTGTCTCCAATTTT
CAAGGAAACATGCCGACTAATCCACCCACTCCTAGGTCGACGATGAGCAGCACCCCATGAACTACACGCAGGCTT
TCCAGTTGGCGCGCGACCCGTCCAATGGCCAATACTTTGTTTTCAACGACATCTTCAAGCTGGTTTACGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail