Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4627
Gene name
Locationscaffold_37:8878..10947
Strand+
Gene length (bp)2069
Transcript length (bp)1599
Coding sequence length (bp)1596
Protein length (aa) 532

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14295 PAN_4 PAN domain 1.4E+00 36 61
PF14295 PAN_4 PAN domain 1.2E+00 142 173
PF14295 PAN_4 PAN domain 8.0E-01 247 265
PF14295 PAN_4 PAN domain 3.9E-02 339 363
PF14295 PAN_4 PAN domain 7.7E-01 455 479

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4627
MKVAFSSVVAVLAAAEYVVAADKKYSCPGDKEETMVTDLAECATRCAANDKCLHSTLVDGNCGLKKAGEEFQLSE
LSTWMFVEKVTTTTQPQTDDAQKPIVGDKTSYSCPTDNKERYTTNGITYEFRCNTGHSKTHWKTVAGSSTKECAD
ICAKEPECYSCDFTHTGTQCALKKAPAALTGWTLGDAWWPVVCPDTRATTATKEPEIASDLNCAANDGKIWEGSD
GTWFYLQCCTDTGAATVVDQGSASSHKDCVEKCVRNKECKRLYGNSAFSTIPGDRVHYAFVTDPPTKAAKLTTSK
RCSTECPDAHGQLYQSVTGENFLMSCYHRYGTNHLKIDRRDSYESCIAACDLMPECRSVEYEPRTKKCFYGTNAE
QATISAKAFLSAHSLGCAGSCSSCKKKGCDKKDNKPLPADAARCDDDHGKLLVAGGTEMRMNCQHCWHSADSTIR
KNPTVKSLADCAKLCGQDPYCHGANWMGPKIGCNLHPRVDADGNGPKMKRNAKCDSVTPLTRSLADYPEDQITDS
GNTERDW
Coding >Ophio5|4627
ATGAAAGTTGCCTTCTCATCCGTCGTGGCCGTCTTGGCCGCGGCAGAGTATGTTGTCGCCGCCGACAAGAAATAC
TCCTGCCCCGGAGACAAGGAGGAGACCATGGTGACCGACCTCGCCGAGTGTGCTACCCGGTGCGCGGCCAATGAC
AAGTGTCTGCACAGTACACTGGTCGATGGGAACTGCGGCCTCAAGAAGGCCGGTGAAGAGTTCCAGTTGTCGGAG
CTCTCGACCTGGATGTTTGTCGAGAAAGTGACTACGACGACGCAGCCGCAAACGGACGACGCACAGAAGCCCATC
GTCGGCGACAAGACTTCCTATTCCTGTCCGACGGACAACAAAGAGAGATACACGACAAACGGCATCACGTACGAG
TTTCGATGCAACACGGGACACAGCAAGACGCACTGGAAGACCGTTGCAGGCTCATCGACGAAGGAGTGCGCCGAT
ATCTGCGCCAAAGAGCCTGAGTGTTACAGCTGTGACTTCACCCACACAGGCACCCAATGTGCCCTCAAGAAGGCT
CCAGCCGCGCTCACCGGGTGGACGCTGGGTGACGCTTGGTGGCCCGTCGTCTGTCCGGATACACGAGCGACGACG
GCGACAAAGGAGCCGGAGATTGCGTCCGACTTGAATTGTGCGGCCAATGACGGAAAGATCTGGGAAGGCTCTGAC
GGAACCTGGTTCTACCTACAATGCTGCACCGACACCGGCGCCGCTACCGTCGTCGATCAGGGGTCGGCGTCGAGC
CACAAGGATTGCGTCGAGAAGTGCGTCAGGAATAAGGAGTGTAAAAGACTCTATGGCAACTCCGCTTTCTCCACC
ATTCCGGGCGACAGAGTGCACTATGCCTTTGTGACGGACCCGCCGACCAAGGCTGCCAAGTTGACCACCTCGAAG
CGGTGCTCAACCGAGTGCCCGGACGCACATGGACAGCTCTACCAGAGTGTGACGGGAGAGAACTTCCTCATGTCC
TGCTACCACCGCTACGGAACCAACCATCTCAAGATTGACCGCCGAGATTCCTACGAGTCTTGCATAGCAGCCTGT
GACCTGATGCCCGAGTGCCGCAGTGTCGAGTACGAGCCGCGGACGAAGAAGTGCTTCTACGGCACCAACGCTGAG
CAGGCCACCATCTCGGCCAAGGCCTTCCTTAGCGCTCACTCTCTCGGCTGCGCTGGGTCCTGTTCCTCGTGCAAG
AAAAAGGGCTGCGACAAAAAGGACAACAAGCCGCTGCCAGCCGACGCGGCGAGATGCGACGACGATCACGGCAAG
TTACTCGTCGCCGGCGGCACCGAGATGCGCATGAACTGCCAGCATTGCTGGCACAGCGCAGACAGCACCATCCGC
AAAAACCCTACAGTCAAGAGCTTAGCCGACTGCGCCAAGCTCTGCGGCCAAGACCCCTATTGCCATGGGGCCAAC
TGGATGGGACCCAAGATCGGCTGCAACCTGCACCCGAGAGTCGACGCCGACGGAAATGGGCCGAAGATGAAGAGG
AATGCCAAATGTGACTCGGTGACTCCCTTGACTAGAAGCTTGGCCGACTACCCGGAAGACCAAATCACGGACTCG
GGTAACACGGAGAGGGACTGG
Transcript >Ophio5|4627
ATGAAAGTTGCCTTCTCATCCGTCGTGGCCGTCTTGGCCGCGGCAGAGTATGTTGTCGCCGCCGACAAGAAATAC
TCCTGCCCCGGAGACAAGGAGGAGACCATGGTGACCGACCTCGCCGAGTGTGCTACCCGGTGCGCGGCCAATGAC
AAGTGTCTGCACAGTACACTGGTCGATGGGAACTGCGGCCTCAAGAAGGCCGGTGAAGAGTTCCAGTTGTCGGAG
CTCTCGACCTGGATGTTTGTCGAGAAAGTGACTACGACGACGCAGCCGCAAACGGACGACGCACAGAAGCCCATC
GTCGGCGACAAGACTTCCTATTCCTGTCCGACGGACAACAAAGAGAGATACACGACAAACGGCATCACGTACGAG
TTTCGATGCAACACGGGACACAGCAAGACGCACTGGAAGACCGTTGCAGGCTCATCGACGAAGGAGTGCGCCGAT
ATCTGCGCCAAAGAGCCTGAGTGTTACAGCTGTGACTTCACCCACACAGGCACCCAATGTGCCCTCAAGAAGGCT
CCAGCCGCGCTCACCGGGTGGACGCTGGGTGACGCTTGGTGGCCCGTCGTCTGTCCGGATACACGAGCGACGACG
GCGACAAAGGAGCCGGAGATTGCGTCCGACTTGAATTGTGCGGCCAATGACGGAAAGATCTGGGAAGGCTCTGAC
GGAACCTGGTTCTACCTACAATGCTGCACCGACACCGGCGCCGCTACCGTCGTCGATCAGGGGTCGGCGTCGAGC
CACAAGGATTGCGTCGAGAAGTGCGTCAGGAATAAGGAGTGTAAAAGACTCTATGGCAACTCCGCTTTCTCCACC
ATTCCGGGCGACAGAGTGCACTATGCCTTTGTGACGGACCCGCCGACCAAGGCTGCCAAGTTGACCACCTCGAAG
CGGTGCTCAACCGAGTGCCCGGACGCACATGGACAGCTCTACCAGAGTGTGACGGGAGAGAACTTCCTCATGTCC
TGCTACCACCGCTACGGAACCAACCATCTCAAGATTGACCGCCGAGATTCCTACGAGTCTTGCATAGCAGCCTGT
GACCTGATGCCCGAGTGCCGCAGTGTCGAGTACGAGCCGCGGACGAAGAAGTGCTTCTACGGCACCAACGCTGAG
CAGGCCACCATCTCGGCCAAGGCCTTCCTTAGCGCTCACTCTCTCGGCTGCGCTGGGTCCTGTTCCTCGTGCAAG
AAAAAGGGCTGCGACAAAAAGGACAACAAGCCGCTGCCAGCCGACGCGGCGAGATGCGACGACGATCACGGCAAG
TTACTCGTCGCCGGCGGCACCGAGATGCGCATGAACTGCCAGCATTGCTGGCACAGCGCAGACAGCACCATCCGC
AAAAACCCTACAGTCAAGAGCTTAGCCGACTGCGCCAAGCTCTGCGGCCAAGACCCCTATTGCCATGGGGCCAAC
TGGATGGGACCCAAGATCGGCTGCAACCTGCACCCGAGAGTCGACGCCGACGGAAATGGGCCGAAGATGAAGAGG
AATGCCAAATGTGACTCGGTGACTCCCTTGACTAGAAGCTTGGCCGACTACCCGGAAGACCAAATCACGGACTCG
GGTAACACGGAGAGGGACTGGTGA
Gene >Ophio5|4627
ATGAAAGTTGCCTTCTCATCCGTCGTGGCCGTCTTGGCCGCGGCAGAGTATGTTGTCGCCGCCGACAAGAAATAC
TCCTGCCCCGGAGACAAGGAGGAGACCATGGTGACGTATGTTCTCTTCTTTTGCTGTGACAACCATCAAAACGGA
GTATCCGGCTGACATATCTGAACAACAAGAGGCGGAAAGAAGTATCAGTTGAAGTGTGGCGTTGGCTTCAAAGGG
ATGCCGATAGAGAATAAGCCATGCAGCGACCTCGCCGAGTGTGCTACCCGGTGCGCGGCCAATGACAAGTGTCTG
CACAGTACACTGGTCGATGGGAACTGCGGCCTCAAGAAGGCCGGTGAAGAGTTCCAGTTGTCGGAGCTCTCGACC
TGGATGTTTGTCGAGAAAGTGACTACGACGACGCAGCCGCAAACGGACGACGCACAGAAGCCCATCGTCGGCGAC
AAGACTTCCTATTCCTGTCCGACGGACAACAAAGAGAGATACACGACGTAAGACGAAATTTGCTGTTTTGGTTTC
TTCGTTCCGTTGATGTACTGACTTGGAATGGGACACTCGGACGACAGAAACGGCATCACGTACGAGTTTCGATGC
AACACGGGACACAGCAAGACGCACTGGAAGACCGTTGCAGGCTCATCGACGAAGGAGTGCGCCGATATCTGCGCC
AAAGAGCCTGAGTGTTACAGCTGTGACTTCACCCACACAGGCACCCAATGTGCCCTCAAGAAGGCTCCAGCCGCG
CTCACCGGGTGGACGCTGGGTGACGCTTGGTGGCCCGTCGTCTGTCCGGATACACGAGCGACGACGGCGACAAAG
GAGCCGGAGATTGCGTCCGACTTGAATTGTGCGGCCAGTATGTCGTCCCTTCCGAACCCTTCTTGTTATGTTATA
TCTGGACACCAGCTTCTGCTAACACGCTTCGCCAAAAAAAAAAAAAAAGATGACGGAAAGATCTGGGAAGGCTCT
GACGGAACCTGGTTCTACCTACAATGCTGCACCGACACCGGCGCCGCTACCGTCGTCGATCAGGGGTCGGCGTCG
AGCCACAAGGATTGCGTCGAGAAGTGCGTCAGGAATAAGGAGTGTAAAAGGTATGGATGGCTCTCATCCACTCCT
TTGTCATGTCTTGTTTACTGACATTCATCCTGTATAGCGCCTCATATGACAGTAAACAGCCAACGGACAACTGCA
GACTCTATGGCAACTCCGCTTTCTCCACCATTCCGGGCGACAGAGTGCACTATGCCTTTGTGACGGACCCGCCGA
CCAAGGCTGCCAAGTTGACCACCTCGAAGCGGTGCTCAACCGAGTGCCCGGACGCACATGGACAGCTCTACCAGA
GTGTGACGGGAGAGGTGAGTTGCCAAGTTAACATACATATGACATATATGTCGTGTCCAGCTGACTCCAGCACAT
TACAGAACTTCCTCATGTCCTGCTACCACCGCTACGGAACCAACCATCTCAAGATTGACCGCCGAGATTCCTACG
AGTCTTGCATAGCAGCCTGTGACCTGATGCCCGAGTGCCGCAGTGTCGAGTACGAGCCGCGGACGAAGAAGTGCT
TCTACGGCACCAACGCTGAGCAGGCCACCATCTCGGCCAAGGCCTTCCTTAGCGCTCACTCTCTCGGCTGCGCTG
GGTCCTGTTCCTCGTGCAAGAAAAAGGGCTGCGACAAAAAGGACAACAAGCCGCTGCCAGCCGACGCGGCGAGAT
GCGACGACGATCACGGCAAGTTACTCGTCGCCGGCGGCACCGAGATGCGCATGAACTGCCAGCATTGCTGGCACA
GCGCAGACAGCACCATCCGCAAAAACCCTACAGTCAAGAGCTTAGCCGACTGCGCCAAGCTCTGCGGCCAAGACC
CCTATTGCCATGGGGCCAACTGGATGGGACCCAAGATCGGCTGCAACCTGCACCCGAGAGTCGACGCCGACGGAA
ATGGGCCGAAGATGAAGAGGAATGCCAAATGTGACTCGGTGACTCCCTTGACTAGAAGCTTGGCCGACTACCCGG
AAGACCAAATCACGGACTCGGGTAACACGGAGAGGGACTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail