Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4623
Gene name
Locationscaffold_369:11246..11820
Strand-
Gene length (bp)574
Transcript length (bp)504
Coding sequence length (bp)501
Protein length (aa) 167

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00160 Pro_isomerase Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD 1.0E-43 3 159

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IPB8|PPIL3_GIBZE Peptidyl-prolyl cis-trans isomerase-like 3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CYP10 PE=3 SV=2 1 167 2.0E-97
sp|Q6MWS8|PPIL3_NEUCR Peptidyl-prolyl cis-trans isomerase-like 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyp-10 PE=3 SV=1 1 166 3.0E-93
sp|P0C1I5|PPIL3_RHIO9 Peptidyl-prolyl cis-trans isomerase-like 3 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp4 PE=3 SV=1 1 166 1.0E-67
sp|Q9LPC7|CP18A_ARATH Peptidyl-prolyl cis-trans isomerase CYP18-1 OS=Arabidopsis thaliana GN=CYP18-1 PE=2 SV=1 1 167 2.0E-65
sp|Q812D3|PPIL3_RAT Peptidyl-prolyl cis-trans isomerase-like 3 OS=Rattus norvegicus GN=Ppil3 PE=2 SV=1 1 166 5.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IPB8|PPIL3_GIBZE Peptidyl-prolyl cis-trans isomerase-like 3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CYP10 PE=3 SV=2 1 167 2.0E-97
sp|Q6MWS8|PPIL3_NEUCR Peptidyl-prolyl cis-trans isomerase-like 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyp-10 PE=3 SV=1 1 166 3.0E-93
sp|P0C1I5|PPIL3_RHIO9 Peptidyl-prolyl cis-trans isomerase-like 3 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp4 PE=3 SV=1 1 166 1.0E-67
sp|Q9LPC7|CP18A_ARATH Peptidyl-prolyl cis-trans isomerase CYP18-1 OS=Arabidopsis thaliana GN=CYP18-1 PE=2 SV=1 1 167 2.0E-65
sp|Q812D3|PPIL3_RAT Peptidyl-prolyl cis-trans isomerase-like 3 OS=Rattus norvegicus GN=Ppil3 PE=2 SV=1 1 166 5.0E-60
sp|Q5ZLV2|PPIL3_CHICK Peptidyl-prolyl cis-trans isomerase-like 3 OS=Gallus gallus GN=PPIL3 PE=2 SV=1 1 166 6.0E-60
sp|Q9H2H8|PPIL3_HUMAN Peptidyl-prolyl cis-trans isomerase-like 3 OS=Homo sapiens GN=PPIL3 PE=1 SV=1 1 166 8.0E-60
sp|P0CP86|PPIL3_CRYNJ Peptidyl-prolyl cis-trans isomerase-like 3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CYP10 PE=3 SV=1 1 166 4.0E-59
sp|P0CP87|PPIL3_CRYNB Peptidyl-prolyl cis-trans isomerase-like 3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CYP10 PE=3 SV=1 1 166 4.0E-59
sp|Q9D6L8|PPIL3_MOUSE Peptidyl-prolyl cis-trans isomerase-like 3 OS=Mus musculus GN=Ppil3 PE=1 SV=1 1 166 4.0E-59
sp|Q4PCH8|PPIL3_USTMA Peptidyl-prolyl cis-trans isomerase-like 3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CYP10 PE=3 SV=1 1 166 6.0E-58
sp|P52017|CYP10_CAEEL Peptidyl-prolyl cis-trans isomerase 10 OS=Caenorhabditis elegans GN=cyn-10 PE=2 SV=2 1 166 7.0E-56
sp|Q54E95|PPIL3_DICDI Peptidyl-prolyl cis-trans isomerase-like 3 OS=Dictyostelium discoideum GN=ppil3 PE=3 SV=1 1 166 9.0E-53
sp|Q5BAH7|PPIL3_EMENI Peptidyl-prolyl cis-trans isomerase-like 3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cyp10 PE=3 SV=2 1 166 4.0E-51
sp|Q4WMB6|PPIL3_ASPFU Peptidyl-prolyl cis-trans isomerase-like 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cyp10 PE=3 SV=2 1 166 6.0E-47
sp|P0C1J1|PPIL2_RHIO9 Peptidyl-prolyl cis-trans isomerase-like 2 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp14 PE=3 SV=1 7 165 5.0E-43
sp|Q9FJX0|PPIL2_ARATH Peptidyl-prolyl cis-trans isomerase CYP65 OS=Arabidopsis thaliana GN=CYP65 PE=2 SV=1 3 164 2.0E-42
sp|Q13356|PPIL2_HUMAN Peptidyl-prolyl cis-trans isomerase-like 2 OS=Homo sapiens GN=PPIL2 PE=1 SV=1 3 164 3.0E-40
sp|P87051|PPIL1_SCHPO Peptidyl-prolyl cis-trans isomerase ppi1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppi1 PE=1 SV=1 2 155 1.0E-39
sp|Q9D787|PPIL2_MOUSE Peptidyl-prolyl cis-trans isomerase-like 2 OS=Mus musculus GN=Ppil2 PE=1 SV=2 3 164 4.0E-39
sp|P0CP84|PPIL1_CRYNJ Peptidyl-prolyl cis-trans isomerase-like 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CYP1 PE=3 SV=1 3 160 5.0E-39
sp|P0CP85|PPIL1_CRYNB Peptidyl-prolyl cis-trans isomerase-like 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CYP1 PE=3 SV=1 3 160 5.0E-39
sp|Q4IBK5|PPIL2_GIBZE Peptidyl-prolyl cis-trans isomerase-like 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CYP8 PE=3 SV=1 5 166 2.0E-38
sp|Q4I1Y1|PPIL1_GIBZE Peptidyl-prolyl cis-trans isomerase-like 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CYP1 PE=3 SV=1 2 160 3.0E-38
sp|Q7SF72|PPIL1_NEUCR Peptidyl-prolyl cis-trans isomerase-like 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ppi-1 PE=3 SV=2 3 160 3.0E-37
sp|Q4WCR3|PPIL1_ASPFU Peptidyl-prolyl cis-trans isomerase-like 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cyp1 PE=3 SV=1 3 160 3.0E-37
sp|Q4P555|PPIL2_USTMA Peptidyl-prolyl cis-trans isomerase-like 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CYP8 PE=3 SV=1 3 165 4.0E-37
sp|Q5ASQ0|PPIL1_EMENI Peptidyl-prolyl cis-trans isomerase-like 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cyp1 PE=3 SV=1 3 160 7.0E-37
sp|Q9NI62|CYPE_DICDI Peptidyl-prolyl cis-trans isomerase cypE OS=Dictyostelium discoideum GN=cypE PE=1 SV=1 2 159 9.0E-37
sp|Q2U6U0|PPIL1_ASPOR Peptidyl-prolyl cis-trans isomerase-like 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cyp1 PE=3 SV=1 3 160 3.0E-36
sp|Q8X191|PPIL1_ASPNG Peptidyl-prolyl cis-trans isomerase-like 1 OS=Aspergillus niger GN=cypC PE=3 SV=1 3 160 4.0E-36
sp|Q8W4D0|CPY71_ARATH Peptidyl-prolyl cis-trans isomerase CYP71 OS=Arabidopsis thaliana GN=CYP71 PE=1 SV=1 2 160 6.0E-36
sp|Q9SIH1|CP18B_ARATH Peptidyl-prolyl cis-trans isomerase CYP18-2 OS=Arabidopsis thaliana GN=CYP18-2 PE=2 SV=1 3 160 8.0E-36
sp|P0C1I4|PPIL1_RHIO9 Peptidyl-prolyl cis-trans isomerase-like 1 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp3 PE=3 SV=1 3 148 2.0E-35
sp|Q2U5W8|PPIL2_ASPOR Peptidyl-prolyl cis-trans isomerase-like 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cyp8 PE=3 SV=1 5 165 4.0E-35
sp|P0CP90|PPIL2_CRYNJ Peptidyl-prolyl cis-trans isomerase-like 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CYP8 PE=3 SV=1 4 165 7.0E-35
sp|P0CP91|PPIL2_CRYNB Peptidyl-prolyl cis-trans isomerase-like 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CYP8 PE=3 SV=1 4 165 7.0E-35
sp|Q4WVU5|PPIL2_ASPFU Peptidyl-prolyl cis-trans isomerase-like 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cyp8 PE=3 SV=2 5 165 1.0E-34
sp|P52012|PPIL2_CAEEL Peptidyl-prolyl cis-trans isomerase 4 OS=Caenorhabditis elegans GN=cyn-4 PE=1 SV=3 3 165 9.0E-34
sp|Q09928|PPIL2_SCHPO Peptidyl-prolyl cis-trans isomerase cyp8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyp8 PE=2 SV=3 7 165 1.0E-33
sp|Q5AXT6|PPIL2_EMENI Peptidyl-prolyl cis-trans isomerase-like 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cyp8 PE=3 SV=1 5 165 3.0E-33
sp|P0C1J2|CWC27_RHIO9 Peptidyl-prolyl isomerase cwc27 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cwc27 PE=3 SV=1 3 165 5.0E-33
sp|Q7RXA6|PPIL2_NEUCR Peptidyl-prolyl cis-trans isomerase-like 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ppi-2 PE=3 SV=1 3 166 6.0E-33
sp|P0C1I7|CYP5_RHIO9 Peptidyl-prolyl cis-trans isomerase cyp5 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp5 PE=3 SV=1 10 135 6.0E-33
sp|Q9Y3C6|PPIL1_HUMAN Peptidyl-prolyl cis-trans isomerase-like 1 OS=Homo sapiens GN=PPIL1 PE=1 SV=1 2 155 3.0E-32
sp|Q5E992|PPIL1_BOVIN Peptidyl-prolyl cis-trans isomerase-like 1 OS=Bos taurus GN=PPIL1 PE=2 SV=1 2 155 3.0E-32
sp|Q9D0W5|PPIL1_MOUSE Peptidyl-prolyl cis-trans isomerase-like 1 OS=Mus musculus GN=Ppil1 PE=1 SV=1 2 155 3.0E-32
sp|O74942|CYP9_SCHPO Peptidyl-prolyl cis-trans isomerase 9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyp9 PE=1 SV=1 5 160 3.0E-32
sp|P0CP92|CWC27_CRYNJ Peptidyl-prolyl isomerase CWC27 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CWC27 PE=3 SV=1 2 165 4.0E-32
sp|P0CP93|CWC27_CRYNB Peptidyl-prolyl isomerase CWC27 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CWC27 PE=3 SV=1 2 165 4.0E-32
sp|Q4P6X6|PPIH_USTMA Peptidyl-prolyl cis-trans isomerase H (Fragment) OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CYP3 PE=3 SV=2 7 158 6.0E-32
sp|Q4R713|CWC27_MACFA Peptidyl-prolyl cis-trans isomerase CWC27 homolog OS=Macaca fascicularis GN=CWC27 PE=2 SV=1 3 165 9.0E-32
sp|Q5R7W3|CWC27_PONAB Peptidyl-prolyl cis-trans isomerase CWC27 homolog OS=Pongo abelii GN=CWC27 PE=2 SV=1 3 165 9.0E-32
sp|Q6UX04|CWC27_HUMAN Peptidyl-prolyl cis-trans isomerase CWC27 homolog OS=Homo sapiens GN=CWC27 PE=1 SV=1 3 165 2.0E-31
sp|Q3TKY6|CWC27_MOUSE Peptidyl-prolyl cis-trans isomerase CWC27 homolog OS=Mus musculus GN=Cwc27 PE=1 SV=1 3 165 4.0E-31
sp|Q5XIB2|CWC27_RAT Peptidyl-prolyl cis-trans isomerase CWC27 homolog OS=Rattus norvegicus GN=Cwc27 PE=1 SV=1 3 165 6.0E-31
sp|O42941|CYP7_SCHPO Peptidylprolyl isomerase cyp7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyp7 PE=1 SV=1 2 155 9.0E-31
sp|Q5XAQ1|BPPI_STRP6 Putative bifunctional phosphatase/peptidyl-prolyl cis-trans isomerase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=M6_Spy1377 PE=1 SV=1 2 160 1.0E-30
sp|Q7ZW86|CWC27_DANRE Peptidyl-prolyl cis-trans isomerase CWC27 homolog OS=Danio rerio GN=cwc27 PE=2 SV=1 3 165 2.0E-30
sp|Q29RZ2|PPWD1_BOVIN Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Bos taurus GN=PPWD1 PE=2 SV=1 2 160 1.0E-29
sp|Q8CEC6|PPWD1_MOUSE Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Mus musculus GN=Ppwd1 PE=1 SV=2 2 160 1.0E-29
sp|Q17QX9|CWC27_BOVIN Peptidyl-prolyl cis-trans isomerase CWC27 homolog OS=Bos taurus GN=CWC27 PE=2 SV=1 3 165 1.0E-29
sp|P0CP82|PPIH_CRYNJ Peptidyl-prolyl cis-trans isomerase H OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CYP3 PE=3 SV=1 7 155 2.0E-29
sp|P0CP83|PPIH_CRYNB Peptidyl-prolyl cis-trans isomerase H OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CYP3 PE=3 SV=1 7 155 2.0E-29
sp|Q4IPB3|CWC27_GIBZE Peptidyl-prolyl isomerase CWC27 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CWC27 PE=3 SV=1 2 165 3.0E-29
sp|Q96BP3|PPWD1_HUMAN Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Homo sapiens GN=PPWD1 PE=1 SV=1 2 160 3.0E-29
sp|Q5NVL7|PPWD1_PONAB Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Pongo abelii GN=PPWD1 PE=2 SV=1 2 160 3.0E-29
sp|P9WHW3|PPIA_MYCTU Peptidyl-prolyl cis-trans isomerase A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppiA PE=1 SV=1 2 160 4.0E-29
sp|P9WHW2|PPIA_MYCTO Peptidyl-prolyl cis-trans isomerase A OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppiA PE=3 SV=1 2 160 4.0E-29
sp|P65763|PPIA_MYCBO Probable peptidyl-prolyl cis-trans isomerase A OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppiA PE=3 SV=1 2 160 4.0E-29
sp|O43447|PPIH_HUMAN Peptidyl-prolyl cis-trans isomerase H OS=Homo sapiens GN=PPIH PE=1 SV=1 9 157 9.0E-29
sp|Q0P5D0|PPIH_BOVIN Peptidyl-prolyl cis-trans isomerase H OS=Bos taurus GN=PPIH PE=2 SV=1 9 157 9.0E-29
sp|Q6GLX7|CWC27_XENLA Peptidyl-prolyl cis-trans isomerase CWC27 homolog OS=Xenopus laevis GN=cwc27 PE=2 SV=1 3 165 3.0E-28
sp|P0C1I8|CYP6_RHIO9 Peptidyl-prolyl cis-trans isomerase cyp6 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp6 PE=3 SV=1 10 135 3.0E-28
sp|P0C1I9|CYP11_RHIO9 Peptidyl-prolyl cis-trans isomerase cyp11 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp11 PE=3 SV=1 7 149 4.0E-28
sp|Q6CBP4|PPID_YARLI Peptidyl-prolyl cis-trans isomerase D OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CPR6 PE=3 SV=1 8 155 7.0E-28
sp|P35627|CYPX_USEUD Peptidyl-prolyl cis-trans isomerase OS=Unspecified eudicot DB-1992 PE=2 SV=1 10 157 1.0E-27
sp|Q9CDE9|PPIA_MYCLE Probable peptidyl-prolyl cis-trans isomerase A OS=Mycobacterium leprae (strain TN) GN=ppiA PE=3 SV=1 2 160 1.0E-27
sp|P0C1J0|CYP15_RHIO9 Peptidyl-prolyl cis-trans isomerase cyp15 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp15 PE=3 SV=1 2 149 3.0E-27
sp|P62936|PPIA_PIG Peptidyl-prolyl cis-trans isomerase A OS=Sus scrofa GN=PPIA PE=1 SV=2 9 141 4.0E-27
sp|P62935|PPIA_BOVIN Peptidyl-prolyl cis-trans isomerase A OS=Bos taurus GN=PPIA PE=1 SV=2 9 141 4.0E-27
sp|B3A0R0|PPI_LOTGI Putative peptidyl-prolyl cis-trans isomerase OS=Lottia gigantea PE=1 SV=1 9 155 4.0E-27
sp|Q6Q152|CPY57_ARATH Peptidyl-prolyl cis-trans isomerase CYP57 OS=Arabidopsis thaliana GN=CYP57 PE=1 SV=1 3 165 5.0E-27
sp|Q0ZQK3|PPIA_SAGOE Peptidyl-prolyl cis-trans isomerase A OS=Saguinus oedipus GN=PPIA PE=3 SV=3 9 141 6.0E-27
sp|Q6DTV9|PPIA_AOTTR Peptidyl-prolyl cis-trans isomerase A OS=Aotus trivirgatus GN=PPIA PE=2 SV=3 9 141 6.0E-27
sp|Q9UA41|PPID_DICDI Peptidyl-prolyl cis-trans isomerase D, mitochondrial OS=Dictyostelium discoideum GN=cypD PE=1 SV=1 6 156 6.0E-27
sp|Q7SBX8|CWC27_NEUCR Peptidyl-prolyl isomerase cwc-27 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cwc-27 PE=3 SV=1 2 165 7.0E-27
sp|Q8CT84|PPI1_STAES Putative peptidyl-prolyl cis-trans isomerase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_0648 PE=3 SV=1 1 161 8.0E-27
sp|Q5HQK8|PPI1_STAEQ Putative peptidyl-prolyl cis-trans isomerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP0540 PE=3 SV=1 1 161 8.0E-27
sp|Q38867|CP19C_ARATH Peptidyl-prolyl cis-trans isomerase CYP19-3 OS=Arabidopsis thaliana GN=CYP19-3 PE=2 SV=2 10 164 9.0E-27
sp|P54985|PPIA_BLAGE Peptidyl-prolyl cis-trans isomerase OS=Blattella germanica GN=CYPA PE=2 SV=1 9 141 9.0E-27
sp|Q26516|PPIE_SCHJA Peptidyl-prolyl cis-trans isomerase E (Fragment) OS=Schistosoma japonicum PE=2 SV=1 10 158 1.0E-26
sp|Q4HXF6|PPID_GIBZE Peptidyl-prolyl cis-trans isomerase D OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CPR6 PE=3 SV=1 8 156 1.0E-26
sp|Q41651|CYPB_VICFA Peptidyl-prolyl cis-trans isomerase, chloroplastic OS=Vicia faba PE=1 SV=1 8 157 1.0E-26
sp|P14851|PPIA_CRIGR Peptidyl-prolyl cis-trans isomerase A OS=Cricetulus griseus GN=PPIA PE=2 SV=2 9 141 1.0E-26
sp|P17742|PPIA_MOUSE Peptidyl-prolyl cis-trans isomerase A OS=Mus musculus GN=Ppia PE=1 SV=2 9 141 1.0E-26
sp|P34791|CP20C_ARATH Peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic OS=Arabidopsis thaliana GN=CYP20-3 PE=1 SV=1 10 155 2.0E-26
sp|Q9QZH3|PPIE_MOUSE Peptidyl-prolyl cis-trans isomerase E OS=Mus musculus GN=Ppie PE=1 SV=2 10 155 2.0E-26
sp|P10111|PPIA_RAT Peptidyl-prolyl cis-trans isomerase A OS=Rattus norvegicus GN=Ppia PE=1 SV=2 9 141 2.0E-26
sp|Q0ZQK6|PPIA_SYMSY Peptidyl-prolyl cis-trans isomerase A OS=Symphalangus syndactylus GN=PPIA PE=3 SV=3 9 141 2.0E-26
sp|Q5R8S7|PPIA_PONPY Peptidyl-prolyl cis-trans isomerase A OS=Pongo pygmaeus GN=PPIA PE=2 SV=4 9 141 2.0E-26
sp|P62941|PPIA_PAPAN Peptidyl-prolyl cis-trans isomerase A OS=Papio anubis GN=PPIA PE=2 SV=2 9 141 2.0E-26
sp|Q0ZQL1|PPIA_PANTR Peptidyl-prolyl cis-trans isomerase A OS=Pan troglodytes GN=PPIA PE=3 SV=3 9 141 2.0E-26
sp|Q0ZQL2|PPIA_PANPA Peptidyl-prolyl cis-trans isomerase A OS=Pan paniscus GN=PPIA PE=3 SV=3 9 141 2.0E-26
sp|Q0ZQK7|PPIA_NOMLE Peptidyl-prolyl cis-trans isomerase A OS=Nomascus leucogenys GN=PPIA PE=3 SV=3 9 141 2.0E-26
sp|P62940|PPIA_MACMU Peptidyl-prolyl cis-trans isomerase A OS=Macaca mulatta GN=PPIA PE=1 SV=2 9 141 2.0E-26
sp|Q0ZQK8|PPIA_HYLLA Peptidyl-prolyl cis-trans isomerase A OS=Hylobates lar GN=PPIA PE=3 SV=3 9 141 2.0E-26
sp|P62937|PPIA_HUMAN Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens GN=PPIA PE=1 SV=2 9 141 2.0E-26
sp|Q0ZQL0|PPIA_GORGO Peptidyl-prolyl cis-trans isomerase A OS=Gorilla gorilla gorilla GN=PPIA PE=3 SV=3 9 141 2.0E-26
sp|P62938|PPIA_CHLAE Peptidyl-prolyl cis-trans isomerase A OS=Chlorocebus aethiops GN=PPIA PE=2 SV=2 9 141 2.0E-26
sp|O94273|PPIB_SCHPO Peptidyl-prolyl cis-trans isomerase B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyp4 PE=3 SV=1 9 155 2.0E-26
sp|Q5U8Z7|PPID_AMAMU Peptidyl-prolyl cis-trans isomerase D OS=Amanita muscaria GN=Cyp40 PE=2 SV=1 10 155 3.0E-26
sp|P0C1I3|PPIH_RHIO9 Peptidyl-prolyl cis-trans isomerase H OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp7 PE=3 SV=1 9 155 3.0E-26
sp|P25719|CYPC_YEAST Peptidyl-prolyl cis-trans isomerase C, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CPR3 PE=1 SV=1 7 156 4.0E-26
sp|P30405|PPIF_HUMAN Peptidyl-prolyl cis-trans isomerase F, mitochondrial OS=Homo sapiens GN=PPIF PE=1 SV=1 9 141 4.0E-26
sp|Q9UNP9|PPIE_HUMAN Peptidyl-prolyl cis-trans isomerase E OS=Homo sapiens GN=PPIE PE=1 SV=1 10 140 4.0E-26
sp|Q8X166|PPIB_ASPNG Peptidyl-prolyl cis-trans isomerase B OS=Aspergillus niger GN=cypB PE=3 SV=1 9 155 4.0E-26
sp|Q42406|CP18D_ARATH Peptidyl-prolyl cis-trans isomerase CYP18-4 OS=Arabidopsis thaliana GN=CYP18-4 PE=1 SV=1 7 150 5.0E-26
sp|Q5R723|PPIE_PONAB Peptidyl-prolyl cis-trans isomerase E OS=Pongo abelii GN=PPIE PE=2 SV=1 10 140 5.0E-26
sp|Q9TTC6|PPIA_RABIT Peptidyl-prolyl cis-trans isomerase A OS=Oryctolagus cuniculus GN=PPIA PE=2 SV=3 9 151 5.0E-26
sp|P29117|PPIF_RAT Peptidyl-prolyl cis-trans isomerase F, mitochondrial OS=Rattus norvegicus GN=Ppif PE=1 SV=2 9 151 5.0E-26
sp|Q4L4W9|PPI1_STAHJ Putative peptidyl-prolyl cis-trans isomerase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH1997 PE=3 SV=1 1 161 5.0E-26
sp|P73789|PPI2_SYNY3 Peptidyl-prolyl cis-trans isomerase slr1251 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1251 PE=3 SV=1 8 140 6.0E-26
sp|Q09637|CYP9_CAEEL Peptidyl-prolyl cis-trans isomerase 9 OS=Caenorhabditis elegans GN=cyn-9 PE=2 SV=3 9 149 6.0E-26
sp|Q99KR7|PPIF_MOUSE Peptidyl-prolyl cis-trans isomerase F, mitochondrial OS=Mus musculus GN=Ppif PE=1 SV=1 9 151 7.0E-26
sp|P0C1H8|PPIA2_RHIO9 Peptidyl-prolyl cis-trans isomerase A2 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp1 PE=3 SV=1 1 134 7.0E-26
sp|Q27774|PPIB_SCHJA Peptidyl-prolyl cis-trans isomerase B OS=Schistosoma japonicum PE=2 SV=1 9 155 9.0E-26
sp|A4FV72|PPIE_BOVIN Peptidyl-prolyl cis-trans isomerase E OS=Bos taurus GN=PPIE PE=2 SV=1 10 140 9.0E-26
sp|P30404|PPIF_BOVIN Peptidyl-prolyl cis-trans isomerase F, mitochondrial OS=Bos taurus GN=PPIF PE=1 SV=3 9 141 9.0E-26
sp|P45877|PPIC_HUMAN Peptidyl-prolyl cis-trans isomerase C OS=Homo sapiens GN=PPIC PE=1 SV=1 9 149 9.0E-26
sp|P0C1H9|PPIB1_RHIO9 Peptidyl-prolyl cis-trans isomerase B1 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp8 PE=3 SV=1 8 155 9.0E-26
sp|Q9CR16|PPID_MOUSE Peptidyl-prolyl cis-trans isomerase D OS=Mus musculus GN=Ppid PE=1 SV=3 9 139 1.0E-25
sp|Q27450|CYP1_BRUMA Peptidyl-prolyl cis-trans isomerase 1 OS=Brugia malayi GN=CYP-1 PE=1 SV=1 10 149 1.0E-25
sp|Q8HXS3|PPIA_FELCA Peptidyl-prolyl cis-trans isomerase A OS=Felis catus GN=PPIA PE=2 SV=3 9 141 1.0E-25
sp|Q6DGG0|PPID_RAT Peptidyl-prolyl cis-trans isomerase D OS=Rattus norvegicus GN=Ppid PE=1 SV=3 9 127 1.0E-25
sp|P0C1I0|PPIB2_RHIO9 Peptidyl-prolyl cis-trans isomerase B2 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp9 PE=3 SV=1 8 155 1.0E-25
sp|Q2UGK2|PPIB_ASPOR Peptidyl-prolyl cis-trans isomerase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cpr2 PE=3 SV=1 9 155 2.0E-25
sp|Q9C566|CYP40_ARATH Peptidyl-prolyl cis-trans isomerase CYP40 OS=Arabidopsis thaliana GN=CYP40 PE=2 SV=1 10 155 2.0E-25
sp|P25007|PPIA_DROME Peptidyl-prolyl cis-trans isomerase OS=Drosophila melanogaster GN=Cyp1 PE=1 SV=2 9 153 2.0E-25
sp|Q26548|PPIE_SCHMA Peptidyl-prolyl cis-trans isomerase E OS=Schistosoma mansoni PE=1 SV=2 10 158 3.0E-25
sp|P34887|CYPH_ALLCE Peptidyl-prolyl cis-trans isomerase OS=Allium cepa GN=CYP PE=2 SV=1 14 155 3.0E-25
sp|A8X8D0|CYP9_CAEBR Peptidyl-prolyl cis-trans isomerase 9 OS=Caenorhabditis briggsae GN=cyn-9 PE=2 SV=2 9 155 3.0E-25
sp|P0C1H7|PPIA1_RHIO9 Peptidyl-prolyl cis-trans isomerase A1 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp2 PE=3 SV=1 9 141 4.0E-25
sp|Q38900|CP19A_ARATH Peptidyl-prolyl cis-trans isomerase CYP19-1 OS=Arabidopsis thaliana GN=CYP19-1 PE=1 SV=1 8 155 4.0E-25
sp|P22011|PPIA_CANAL Peptidyl-prolyl cis-trans isomerase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CYP1 PE=3 SV=1 9 141 5.0E-25
sp|P52018|CYP11_CAEEL Peptidyl-prolyl cis-trans isomerase 11 OS=Caenorhabditis elegans GN=cyn-11 PE=2 SV=1 9 155 5.0E-25
sp|Q08E11|PPIC_BOVIN Peptidyl-prolyl cis-trans isomerase C OS=Bos taurus GN=PPIC PE=2 SV=1 9 149 5.0E-25
sp|A0A0B4J2A2|PAL4C_HUMAN Peptidyl-prolyl cis-trans isomerase A-like 4C OS=Homo sapiens GN=PPIAL4C PE=2 SV=1 9 141 6.0E-25
sp|Q5HHD1|PPI1_STAAC Putative peptidyl-prolyl cis-trans isomerase OS=Staphylococcus aureus (strain COL) GN=SACOL0957 PE=3 SV=1 1 160 6.0E-25
sp|Q4WP12|PPIB_ASPFU Peptidyl-prolyl cis-trans isomerase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cpr2 PE=3 SV=1 9 155 7.0E-25
sp|Q7A1C0|PPI1_STAAW Putative peptidyl-prolyl cis-trans isomerase OS=Staphylococcus aureus (strain MW2) GN=MW0836 PE=3 SV=1 1 160 7.0E-25
sp|Q6GAX2|PPI1_STAAS Putative peptidyl-prolyl cis-trans isomerase OS=Staphylococcus aureus (strain MSSA476) GN=SAS0824 PE=3 SV=1 1 160 7.0E-25
sp|Q6GID4|PPI1_STAAR Putative peptidyl-prolyl cis-trans isomerase OS=Staphylococcus aureus (strain MRSA252) GN=SAR0916 PE=3 SV=1 1 160 7.0E-25
sp|Q7A6I1|PPI1_STAAN Putative peptidyl-prolyl cis-trans isomerase OS=Staphylococcus aureus (strain N315) GN=SA0815 PE=1 SV=1 1 160 7.0E-25
sp|Q99VD4|PPI1_STAAM Putative peptidyl-prolyl cis-trans isomerase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV0954 PE=3 SV=1 1 160 7.0E-25
sp|Q2YWT2|PPI1_STAAB Putative peptidyl-prolyl cis-trans isomerase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB0821 PE=3 SV=1 1 160 7.0E-25
sp|Q2FZU9|PPI1_STAA8 Putative peptidyl-prolyl cis-trans isomerase OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_00891 PE=3 SV=1 1 160 7.0E-25
sp|Q2FIC1|PPI1_STAA3 Putative peptidyl-prolyl cis-trans isomerase OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_0857 PE=3 SV=1 1 160 7.0E-25
sp|P0DN26|PAL4F_HUMAN Peptidyl-prolyl cis-trans isomerase A-like 4F OS=Homo sapiens GN=PPIAL4F PE=3 SV=1 9 141 7.0E-25
sp|A0A075B759|PAL4E_HUMAN Peptidyl-prolyl cis-trans isomerase A-like 4E OS=Homo sapiens GN=PPIAL4E PE=3 SV=1 9 141 7.0E-25
sp|P24525|CYPH_BRANA Peptidyl-prolyl cis-trans isomerase OS=Brassica napus GN=CYP PE=2 SV=2 3 156 7.0E-25
sp|Q9ASS6|PNSL5_ARATH Photosynthetic NDH subunit of lumenal location 5, chloroplastic OS=Arabidopsis thaliana GN=PNSL5 PE=1 SV=1 10 155 7.0E-25
sp|P52014|CYP6_CAEEL Peptidyl-prolyl cis-trans isomerase 6 OS=Caenorhabditis elegans GN=cyn-6 PE=2 SV=1 9 155 8.0E-25
sp|Q26551|PPIB_SCHMA Peptidyl-prolyl cis-trans isomerase B OS=Schistosoma mansoni GN=CYP PE=2 SV=1 14 155 8.0E-25
sp|P18253|CYPH_SCHPO Peptidyl-prolyl cis-trans isomerase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppi1 PE=3 SV=1 9 140 9.0E-25
sp|Q8W171|CYP1_SOYBN Peptidyl-prolyl cis-trans isomerase 1 OS=Glycine max GN=Cyp1 PE=2 SV=1 8 155 9.0E-25
sp|F5H284|PAL4D_HUMAN Peptidyl-prolyl cis-trans isomerase A-like 4D OS=Homo sapiens GN=PPIAL4D PE=3 SV=1 9 126 1.0E-24
sp|P26882|PPID_BOVIN Peptidyl-prolyl cis-trans isomerase D OS=Bos taurus GN=PPID PE=1 SV=6 9 127 1.0E-24
sp|P91791|PPIA_HEMPU Peptidyl-prolyl cis-trans isomerase OS=Hemicentrotus pulcherrimus PE=2 SV=1 9 151 1.0E-24
sp|Q08752|PPID_HUMAN Peptidyl-prolyl cis-trans isomerase D OS=Homo sapiens GN=PPID PE=1 SV=3 9 127 1.0E-24
sp|P0C1I2|PPIE_RHIO9 Peptidyl-prolyl cis-trans isomerase E OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp10 PE=3 SV=1 6 127 1.0E-24
sp|P30412|PPIC_MOUSE Peptidyl-prolyl cis-trans isomerase C OS=Mus musculus GN=Ppic PE=1 SV=1 9 149 2.0E-24
sp|O93826|PPIB_ARTBE Peptidyl-prolyl cis-trans isomerase B OS=Arthroderma benhamiae GN=CPR2 PE=2 SV=1 9 155 2.0E-24
sp|D4AY02|CYPB_ARTBC Probable peptidyl-prolyl cis-trans isomerase ARB_01071 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01071 PE=1 SV=2 9 155 2.0E-24
sp|P52009|CYP1_CAEEL Peptidyl-prolyl cis-trans isomerase 1 OS=Caenorhabditis elegans GN=cyn-1 PE=2 SV=1 10 133 2.0E-24
sp|Q4WAQ9|PPIL4_ASPFU Peptidyl-prolyl cis-trans isomerase-like 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cyp6 PE=3 SV=1 1 164 2.0E-24
sp|Q5ACI8|PPID_CANAL Peptidyl-prolyl cis-trans isomerase D OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CPR6 PE=3 SV=2 10 155 2.0E-24
sp|P0C1I6|PPIL4_RHIO9 Peptidyl-prolyl cis-trans isomerase-like 4 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp13 PE=3 SV=1 1 165 2.0E-24
sp|Q6CL78|PPID_KLULA Peptidyl-prolyl cis-trans isomerase D OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CPR6 PE=3 SV=1 10 156 2.0E-24
sp|P0DN37|PAL4G_HUMAN Peptidyl-prolyl cis-trans isomerase A-like 4G OS=Homo sapiens GN=PPIAL4G PE=3 SV=1 9 141 2.0E-24
sp|Q9D868|PPIH_MOUSE Peptidyl-prolyl cis-trans isomerase H OS=Mus musculus GN=Ppih PE=1 SV=1 9 139 2.0E-24
sp|Q9SKQ0|CP19B_ARATH Peptidyl-prolyl cis-trans isomerase CYP19-2 OS=Arabidopsis thaliana GN=CYP19-2 PE=1 SV=1 10 155 2.0E-24
sp|Q9ZVJ4|CYP22_ARATH Peptidyl-prolyl cis-trans isomerase CYP22 OS=Arabidopsis thaliana GN=CYP22 PE=2 SV=1 10 150 3.0E-24
sp|Q5B4R3|PPIB_EMENI Peptidyl-prolyl cis-trans isomerase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cpr2 PE=3 SV=1 8 155 4.0E-24
sp|Q9LY75|CYP63_ARATH Peptidyl-prolyl cis-trans isomerase CYP63 OS=Arabidopsis thaliana GN=CYP63 PE=1 SV=1 14 155 4.0E-24
sp|P84343|PPIA_NEOCA Peptidyl-prolyl cis-trans isomerase OS=Neospora caninum PE=1 SV=1 8 160 5.0E-24
sp|P21568|CYPH_SOLLC Peptidyl-prolyl cis-trans isomerase OS=Solanum lycopersicum GN=CYP PE=2 SV=1 10 155 5.0E-24
sp|Q6Q151|CYP59_ARATH Peptidyl-prolyl cis-trans isomerase CYP59 OS=Arabidopsis thaliana GN=CYP59 PE=1 SV=1 1 165 6.0E-24
sp|Q4P7H2|CWC27_USTMA Peptidyl-prolyl isomerase CWC27 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CWC27 PE=3 SV=1 3 165 6.0E-24
sp|Q5B4E7|PPID_EMENI Peptidyl-prolyl cis-trans isomerase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cpr6 PE=3 SV=1 6 145 6.0E-24
sp|Q8LDP4|CP19D_ARATH Peptidyl-prolyl cis-trans isomerase CYP19-4 OS=Arabidopsis thaliana GN=CYP19-4 PE=1 SV=2 8 140 6.0E-24
sp|P0C1I1|PPID_RHIO9 Peptidyl-prolyl cis-trans isomerase D OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp12 PE=3 SV=1 10 144 7.0E-24
sp|P52010|CYP2_CAEEL Peptidyl-prolyl cis-trans isomerase 2 OS=Caenorhabditis elegans GN=cyn-2 PE=2 SV=2 10 140 8.0E-24
sp|Q7S7Z6|PPIB_NEUCR Peptidyl-prolyl cis-trans isomerase B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpr2 PE=3 SV=3 9 157 8.0E-24
sp|O00060|CYPH_UROFA Peptidyl-prolyl cis-trans isomerase OS=Uromyces fabae GN=PIG28 PE=2 SV=1 9 127 1.0E-23
sp|Q06118|PPIA_STRAQ Peptidyl-prolyl cis-trans isomerase A OS=Streptomyces anulatus GN=ppiA PE=1 SV=1 10 140 1.0E-23
sp|P21569|CYPH_MAIZE Peptidyl-prolyl cis-trans isomerase OS=Zea mays GN=CYP PE=2 SV=1 10 139 1.0E-23
sp|Q9P3X9|PPID_NEUCR 41 kDa peptidyl-prolyl cis-trans isomerase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyp41 PE=1 SV=1 10 133 2.0E-23
sp|Q8SRE1|CYPH_ENCCU Peptidyl-prolyl cis-trans isomerase OS=Encephalitozoon cuniculi (strain GB-M1) GN=CPR1 PE=1 SV=1 8 156 2.0E-23
sp|P14832|CYPH_YEAST Peptidyl-prolyl cis-trans isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CPR1 PE=1 SV=3 9 127 2.0E-23
sp|P10255|CYPH_NEUCR Peptidyl-prolyl cis-trans isomerase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=csr-1 PE=1 SV=1 10 140 2.0E-23
sp|Q9Y536|PAL4A_HUMAN Peptidyl-prolyl cis-trans isomerase A-like 4A OS=Homo sapiens GN=PPIAL4A PE=2 SV=1 9 141 2.0E-23
sp|P34790|CP18C_ARATH Peptidyl-prolyl cis-trans isomerase CYP18-3 OS=Arabidopsis thaliana GN=CYP18-3 PE=1 SV=1 10 155 3.0E-23
sp|Q4I5R9|PPIB_GIBZE Peptidyl-prolyl cis-trans isomerase B OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CPR2 PE=3 SV=2 9 157 4.0E-23
sp|O66105|PPIB_TREPA Probable peptidyl-prolyl cis-trans isomerase OS=Treponema pallidum (strain Nichols) GN=ppiB PE=1 SV=1 4 127 4.0E-23
sp|P0CP81|PPID_CRYNB Peptidyl-prolyl cis-trans isomerase D OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CPR6 PE=3 SV=1 10 155 4.0E-23
sp|P0CP80|PPID_CRYNJ Peptidyl-prolyl cis-trans isomerase D OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CPR6 PE=3 SV=1 10 155 4.0E-23
sp|P30414|NKTR_HUMAN NK-tumor recognition protein OS=Homo sapiens GN=NKTR PE=1 SV=2 9 155 5.0E-23
sp|Q01490|PPIB_ORPSP Peptidyl-prolyl cis-trans isomerase B OS=Orpinomyces sp. (strain PC-2) GN=CYPB PE=1 SV=1 9 155 5.0E-23
sp|O49886|CYPH_LUPLU Peptidyl-prolyl cis-trans isomerase OS=Lupinus luteus PE=2 SV=1 10 139 6.0E-23
sp|P52015|CYP7_CAEEL Peptidyl-prolyl cis-trans isomerase 7 OS=Caenorhabditis elegans GN=cyn-7 PE=1 SV=2 10 140 6.0E-23
sp|Q4P0V4|PPID_USTMA Peptidyl-prolyl cis-trans isomerase D OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CPR6 PE=3 SV=1 14 155 6.0E-23
sp|Q39613|CYPH_CATRO Peptidyl-prolyl cis-trans isomerase OS=Catharanthus roseus GN=PCKR1 PE=1 SV=1 10 139 9.0E-23
sp|Q4WIF3|PPID_ASPFU Peptidyl-prolyl cis-trans isomerase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cpr6 PE=3 SV=1 17 145 9.0E-23
sp|Q9TW32|PPIB_DICDI Peptidyl-prolyl cis-trans isomerase B OS=Dictyostelium discoideum GN=cypB PE=1 SV=1 10 135 1.0E-22
sp|P52013|CYP5_CAEEL Peptidyl-prolyl cis-trans isomerase 5 OS=Caenorhabditis elegans GN=cyn-5 PE=1 SV=2 9 155 1.0E-22
sp|Q6FNU6|PPID_CANGA Peptidyl-prolyl cis-trans isomerase D OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CPR6 PE=3 SV=1 10 156 2.0E-22
sp|Q6BXZ7|PPID_DEBHA Peptidyl-prolyl cis-trans isomerase D OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CPR6 PE=3 SV=1 10 133 2.0E-22
sp|Q9ZJH5|PPIA_HELPJ Peptidyl-prolyl cis-trans isomerase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=ppiA PE=3 SV=1 4 139 2.0E-22
sp|Q11004|PPID_SCHPO 40 kDa peptidyl-prolyl cis-trans isomerase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis2 PE=2 SV=1 14 139 2.0E-22
sp|P52016|CYP8_CAEEL Peptidyl-prolyl cis-trans isomerase 8 OS=Caenorhabditis elegans GN=cyn-8 PE=2 SV=1 10 149 2.0E-22
sp|Q4IPH4|PPIH_GIBZE Peptidyl-prolyl cis-trans isomerase H OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CYP3 PE=3 SV=1 9 140 2.0E-22
sp|Q4G338|PPIE_HAECO Peptidyl-prolyl cis-trans isomerase E OS=Haemonchus contortus PE=1 SV=1 9 139 3.0E-22
sp|Q9SP02|CP20A_ARATH Peptidyl-prolyl cis-trans isomerase CYP20-1 OS=Arabidopsis thaliana GN=CYP20-1 PE=1 SV=1 10 127 3.0E-22
sp|P24367|PPIB_CHICK Peptidyl-prolyl cis-trans isomerase B OS=Gallus gallus GN=PPIB PE=2 SV=1 10 155 3.0E-22
sp|Q49W93|PPI1_STAS1 Putative peptidyl-prolyl cis-trans isomerase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1821 PE=3 SV=1 1 160 3.0E-22
sp|P24369|PPIB_MOUSE Peptidyl-prolyl cis-trans isomerase B OS=Mus musculus GN=Ppib PE=1 SV=2 8 155 3.0E-22
sp|P48820|RBP2_BOVIN E3 SUMO-protein ligase RanBP2 (Fragment) OS=Bos taurus GN=RANBP2 PE=2 SV=2 9 141 4.0E-22
sp|P53691|PPID_YEAST Peptidyl-prolyl cis-trans isomerase CPR6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CPR6 PE=1 SV=1 10 154 4.0E-22
sp|Q8L8W5|CP21B_ARATH Peptidyl-prolyl cis-trans isomerase CYP21-2 OS=Arabidopsis thaliana GN=CYP21-2 PE=2 SV=1 10 145 4.0E-22
sp|P23285|CYPB_YEAST Peptidyl-prolyl cis-trans isomerase B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CPR2 PE=1 SV=1 9 157 4.0E-22
sp|P77949|PPIB_STRAQ Peptidyl-prolyl cis-trans isomerase B OS=Streptomyces anulatus GN=cypB PE=1 SV=1 1 161 4.0E-22
sp|P80311|PPIB_BOVIN Peptidyl-prolyl cis-trans isomerase B OS=Bos taurus GN=PPIB PE=1 SV=4 9 155 4.0E-22
sp|Q871A4|PPIL4_NEUCR Peptidyl-prolyl cis-trans isomerase-like 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyp-6 PE=3 SV=1 1 164 5.0E-22
sp|P30415|NKTR_MOUSE NK-tumor recognition protein OS=Mus musculus GN=Nktr PE=1 SV=4 9 155 5.0E-22
sp|P52011|CYP3_CAEEL Peptidyl-prolyl cis-trans isomerase 3 OS=Caenorhabditis elegans GN=cyn-3 PE=1 SV=1 10 140 6.0E-22
sp|P0CP78|PPIB_CRYNJ Peptidyl-prolyl cis-trans isomerase B OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CPR2 PE=3 SV=1 9 155 7.0E-22
sp|P0CP79|PPIB_CRYNB Peptidyl-prolyl cis-trans isomerase B OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CPR2 PE=3 SV=1 9 155 7.0E-22
sp|P23284|PPIB_HUMAN Peptidyl-prolyl cis-trans isomerase B OS=Homo sapiens GN=PPIB PE=1 SV=2 9 149 9.0E-22
sp|Q9ERU9|RBP2_MOUSE E3 SUMO-protein ligase RanBP2 OS=Mus musculus GN=Ranbp2 PE=1 SV=2 9 141 1.0E-21
sp|Q13427|PPIG_HUMAN Peptidyl-prolyl cis-trans isomerase G OS=Homo sapiens GN=PPIG PE=1 SV=2 10 155 1.0E-21
sp|O55035|PPIG_RAT Peptidyl-prolyl cis-trans isomerase G OS=Rattus norvegicus GN=Ppig PE=1 SV=2 10 155 1.0E-21
sp|P24368|PPIB_RAT Peptidyl-prolyl cis-trans isomerase B OS=Rattus norvegicus GN=Ppib PE=1 SV=3 9 155 1.0E-21
sp|Q4WE62|CWC27_ASPFU Peptidyl-prolyl isomerase cwc27 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cwc27 PE=3 SV=1 2 167 2.0E-21
sp|Q5ARI5|PPIL4_EMENI Peptidyl-prolyl cis-trans isomerase-like 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cyp6 PE=3 SV=1 1 165 2.0E-21
sp|O00845|PPIA_PARPR Peptidyl-prolyl cis-trans isomerase OS=Paramecium primaurelia PE=3 SV=1 14 155 2.0E-21
sp|P49792|RBP2_HUMAN E3 SUMO-protein ligase RanBP2 OS=Homo sapiens GN=RANBP2 PE=1 SV=2 9 141 2.0E-21
sp|Q5AUG9|CWC27_EMENI Peptidyl-prolyl isomerase cwc27 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cwc27 PE=3 SV=1 2 155 2.0E-21
sp|Q9V3G3|PPIE_DROME Peptidyl-prolyl cis-trans isomerase E OS=Drosophila melanogaster GN=cyp33 PE=1 SV=1 21 133 2.0E-21
sp|P0CP88|PPIL4_CRYNJ Peptidyl-prolyl cis-trans isomerase-like 4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CYP6 PE=3 SV=1 1 165 2.0E-21
sp|P0CP89|PPIL4_CRYNB Peptidyl-prolyl cis-trans isomerase-like 4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CYP6 PE=3 SV=1 1 165 2.0E-21
sp|P15425|CYPR_DROME Peptidyl-prolyl cis-trans isomerase, rhodopsin-specific isozyme OS=Drosophila melanogaster GN=ninaA PE=1 SV=1 9 156 2.0E-21
sp|Q8IXY8|PPIL6_HUMAN Peptidyl-prolyl cis-trans isomerase-like 6 OS=Homo sapiens GN=PPIL6 PE=2 SV=1 9 166 2.0E-21
sp|A2AR02|PPIG_MOUSE Peptidyl-prolyl cis-trans isomerase G OS=Mus musculus GN=Ppig PE=1 SV=1 10 155 2.0E-21
sp|P28517|CYPR_CALVI Peptidyl-prolyl cis-trans isomerase, rhodopsin-specific isozyme OS=Calliphora vicina GN=NINAA PE=2 SV=1 9 155 3.0E-21
sp|Q7SG06|PPIH_NEUCR Peptidyl-prolyl cis-trans isomerase H OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyp-3 PE=3 SV=1 9 127 3.0E-21
sp|Q75A33|PPID_ASHGO Peptidyl-prolyl cis-trans isomerase D OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CPR6 PE=3 SV=1 10 160 3.0E-21
sp|Q2U0E0|PPID_ASPOR Peptidyl-prolyl cis-trans isomerase D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cpr6 PE=3 SV=1 6 133 3.0E-21
sp|H2QII6|RBP2_PANTR E3 SUMO-protein ligase RanBP2 OS=Pan troglodytes GN=RANBP2 PE=1 SV=1 9 141 5.0E-21
sp|Q4IE79|PPIL4_GIBZE Peptidyl-prolyl cis-trans isomerase-like 4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CYP6 PE=3 SV=2 1 166 6.0E-21
sp|Q8WUA2|PPIL4_HUMAN Peptidyl-prolyl cis-trans isomerase-like 4 OS=Homo sapiens GN=PPIL4 PE=1 SV=1 1 160 7.0E-21
sp|Q9CXG3|PPIL4_MOUSE Peptidyl-prolyl cis-trans isomerase-like 4 OS=Mus musculus GN=Ppil4 PE=1 SV=2 1 160 8.0E-21
sp|Q5AQL0|PPIH_EMENI Peptidyl-prolyl cis-trans isomerase H OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cyp3 PE=3 SV=2 9 135 9.0E-21
sp|Q9UUE4|PPIL4_SCHPO Peptidyl-prolyl cis-trans isomerase cyp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyp6 PE=1 SV=1 1 165 1.0E-20
sp|Q54SM3|PPIA_DICDI Peptidyl-prolyl cis-trans isomerase A OS=Dictyostelium discoideum GN=ppiA PE=1 SV=1 10 140 1.0E-20
sp|Q6C4W6|PPIB_YARLI Peptidyl-prolyl cis-trans isomerase B OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CPR2 PE=3 SV=1 8 155 1.0E-20
sp|P35176|CYPD_YEAST Peptidyl-prolyl cis-trans isomerase D OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CPR5 PE=2 SV=1 9 165 2.0E-20
sp|P14088|PPIA_ECHGR Peptidyl-prolyl cis-trans isomerase OS=Echinococcus granulosus GN=CYP-1 PE=2 SV=2 19 153 2.0E-20
sp|O25982|PPIA_HELPY Peptidyl-prolyl cis-trans isomerase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=ppiA PE=3 SV=1 4 139 2.0E-20
sp|O49605|CP21A_ARATH Peptidyl-prolyl cis-trans isomerase CYP21-1 OS=Arabidopsis thaliana GN=CYP21-1 PE=2 SV=1 9 155 2.0E-20
sp|Q1RMP7|PPIL6_BOVIN Peptidyl-prolyl cis-trans isomerase-like 6 OS=Bos taurus GN=PPIL6 PE=2 SV=1 9 149 7.0E-20
sp|P29820|PPI_SYNE7 Peptidyl-prolyl cis-trans isomerase OS=Synechococcus elongatus (strain PCC 7942) GN=rot PE=3 SV=1 5 139 8.0E-20
sp|Q2U256|PPIL4_ASPOR Peptidyl-prolyl cis-trans isomerase-like 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cyp6 PE=3 SV=1 1 165 1.0E-19
sp|O74729|PPIH_SCHPO Peptidyl-prolyl cis-trans isomerase cyp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyp3 PE=3 SV=1 9 155 3.0E-19
sp|Q4WCM6|PPIH_ASPFU Peptidyl-prolyl cis-trans isomerase H OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cyp3 PE=3 SV=2 9 135 5.0E-19
sp|P35137|PPIB_BACSU Peptidyl-prolyl cis-trans isomerase B OS=Bacillus subtilis (strain 168) GN=ppiB PE=1 SV=1 12 126 2.0E-18
sp|Q26565|PPIA_SCHMA Peptidyl-prolyl cis-trans isomerase OS=Schistosoma mansoni PE=1 SV=1 9 156 4.0E-18
sp|Q2TZ33|PPIH_ASPOR Peptidyl-prolyl cis-trans isomerase H OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cyp3 PE=3 SV=1 8 155 7.0E-18
sp|P47103|CYP7_YEAST Peptidyl-prolyl cis-trans isomerase CYP7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CPR7 PE=1 SV=1 9 155 4.0E-16
sp|P0C196|PPIL4_USTMA Peptidyl-prolyl cis-trans isomerase-like 4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CYP6 PE=3 SV=1 1 166 1.0E-15
sp|P42693|PPIA_ACIAD Peptidyl-prolyl cis-trans isomerase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rotA PE=3 SV=1 3 162 1.0E-13
sp|Q57D43|PPI1_BRUAB Probable peptidyl-prolyl cis-trans isomerase OS=Brucella abortus biovar 1 (strain 9-941) GN=ppi PE=3 SV=1 2 163 3.0E-13
sp|Q2YPY5|PPI1_BRUA2 Probable peptidyl-prolyl cis-trans isomerase OS=Brucella abortus (strain 2308) GN=ppi PE=3 SV=1 2 163 3.0E-13
sp|Q8G0J9|PPI1_BRUSU Probable peptidyl-prolyl cis-trans isomerase OS=Brucella suis biovar 1 (strain 1330) GN=ppi PE=3 SV=1 2 163 5.0E-13
sp|Q8YHB5|PPI1_BRUME Probable peptidyl-prolyl cis-trans isomerase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ppi PE=3 SV=2 2 163 5.0E-13
sp|P44499|PPIB_HAEIN Peptidyl-prolyl cis-trans isomerase B OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ppiB PE=3 SV=1 3 132 8.0E-13
sp|Q8RWY7|CYP95_ARATH Peptidyl-prolyl cis-trans isomerase CYP95 OS=Arabidopsis thaliana GN=CYP95 PE=1 SV=2 14 157 4.0E-12
sp|Q59641|PPIA_PSEAE Peptidyl-prolyl cis-trans isomerase A OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ppiA PE=3 SV=2 3 127 3.0E-11
sp|P23869|PPIB_ECOLI Peptidyl-prolyl cis-trans isomerase B OS=Escherichia coli (strain K12) GN=ppiB PE=1 SV=2 3 109 4.0E-11
sp|Q94A16|CP21C_ARATH Peptidyl-prolyl cis-trans isomerase CYP21-3, mitochondrial OS=Arabidopsis thaliana GN=CYP21-3 PE=2 SV=2 4 160 5.0E-11
sp|Q6CGK4|CWC27_YARLI Peptidyl-prolyl isomerase CWC27 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CWC27 PE=3 SV=1 2 129 1.0E-10
sp|P20753|PPIA_SALTY Peptidyl-prolyl cis-trans isomerase A OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ppiA PE=3 SV=2 3 127 2.0E-10
sp|P0AFL3|PPIA_ECOLI Peptidyl-prolyl cis-trans isomerase A OS=Escherichia coli (strain K12) GN=ppiA PE=1 SV=1 3 127 2.0E-10
sp|P0AFL4|PPIA_ECOL6 Peptidyl-prolyl cis-trans isomerase A OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ppiA PE=3 SV=1 3 127 2.0E-10
sp|P0AFL5|PPIA_ECO57 Peptidyl-prolyl cis-trans isomerase A OS=Escherichia coli O157:H7 GN=ppiA PE=3 SV=1 3 127 2.0E-10
sp|P83221|PPIB_STRAT Peptidyl-prolyl cis-trans isomerase cyp18 OS=Streptomyces antibioticus GN=cyp18 PE=1 SV=3 2 55 3.0E-10
sp|O53021|PPIA_DICD3 Peptidyl-prolyl cis-trans isomerase A OS=Dickeya dadantii (strain 3937) GN=rotA PE=3 SV=2 3 160 6.0E-10
sp|Q6BWH6|CWC27_DEBHA Peptidyl-prolyl isomerase CWC27 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CWC27 PE=3 SV=1 3 160 8.0E-10
sp|P9WHW1|PPIB_MYCTU Probable peptidyl-prolyl cis-trans isomerase B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppiB PE=1 SV=1 1 138 1.0E-08
sp|P9WHW0|PPIB_MYCTO Probable peptidyl-prolyl cis-trans isomerase B OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppiB PE=3 SV=1 1 138 1.0E-08
sp|Q9C835|CP21D_ARATH Peptidyl-prolyl cis-trans isomerase CYP21-4 OS=Arabidopsis thaliana GN=CYP21-4 PE=2 SV=1 5 160 2.0E-08
sp|P46697|PPIB_MYCLE Probable peptidyl-prolyl cis-trans isomerase B OS=Mycobacterium leprae (strain TN) GN=ppiB PE=3 SV=1 1 138 2.0E-08
sp|Q9LIK6|CP26A_ARATH Peptidyl-prolyl cis-trans isomerase CYP26-1 OS=Arabidopsis thaliana GN=CYP26-1 PE=2 SV=1 10 155 4.0E-08
sp|Q8LDR3|CYP23_ARATH Peptidyl-prolyl cis-trans isomerase CYP23 OS=Arabidopsis thaliana GN=CYP23 PE=2 SV=1 3 160 7.0E-08
sp|Q9D6D8|PPIL6_MOUSE Peptidyl-prolyl cis-trans isomerase-like 6 OS=Mus musculus GN=Ppil6 PE=1 SV=1 9 98 1.0E-07
sp|P72704|PPI1_SYNY3 Probable peptidyl-prolyl cis-trans isomerase sll0227 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0227 PE=3 SV=1 14 126 6.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0003755 peptidyl-prolyl cis-trans isomerase activity Yes
GO:0000413 protein peptidyl-prolyl isomerization Yes
GO:0043170 macromolecule metabolic process No
GO:0016859 cis-trans isomerase activity No
GO:0008150 biological_process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0018208 peptidyl-proline modification No
GO:0016853 isomerase activity No
GO:0043412 macromolecule modification No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0071704 organic substance metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0019538 protein metabolic process No
GO:0036211 protein modification process No
GO:0018193 peptidyl-amino acid modification No
GO:0006807 nitrogen compound metabolic process No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 25.60 8.39 42.82
CcL In ants, during behavior modification 49.48 19.18 79.77
CcD In ants, recently dead 33.22 11.81 54.63

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.037825 yes
SC16a CcD 0.458623 no
CcL CcD 0.215750 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4623
MSVTLHTTVGDLKLEVFCESVPKTAENFLALCASGYYDGSPFHRLIPQFMAQTGAPAEPRPPHLPKAGTSIWGTA
FDDEIRPSLTHASRGILSMANKGPATNGSQFFITFDKAPHLDGLNTVFGKLIGDEALVTLASIEAFPVDAKNRPK
EPLRIERVTIHANPLAG
Coding >Ophio5|4623
ATGTCCGTCACGCTGCACACCACCGTTGGCGACCTCAAGCTTGAAGTCTTTTGTGAGAGCGTACCAAAGACCGCC
GAGAACTTCCTCGCCCTCTGCGCCTCCGGCTATTACGATGGCTCGCCCTTCCATCGCCTCATTCCCCAGTTCATG
GCCCAAACCGGCGCGCCCGCCGAGCCTCGTCCGCCGCACCTCCCCAAGGCCGGCACCTCCATATGGGGCACCGCC
TTCGACGACGAGATCCGCCCGTCGCTGACGCACGCCTCACGCGGCATCCTCTCCATGGCTAACAAGGGTCCCGCC
ACCAATGGCTCGCAGTTCTTCATAACCTTCGACAAGGCGCCCCATCTAGACGGCCTCAATACCGTCTTCGGGAAG
CTCATTGGCGACGAGGCTCTCGTTACGCTGGCCAGCATCGAGGCTTTCCCTGTCGATGCCAAGAATCGCCCCAAG
GAGCCGCTCCGCATTGAACGCGTCACCATTCATGCGAACCCTCTGGCCGGC
Transcript >Ophio5|4623
ATGTCCGTCACGCTGCACACCACCGTTGGCGACCTCAAGCTTGAAGTCTTTTGTGAGAGCGTACCAAAGACCGCC
GAGAACTTCCTCGCCCTCTGCGCCTCCGGCTATTACGATGGCTCGCCCTTCCATCGCCTCATTCCCCAGTTCATG
GCCCAAACCGGCGCGCCCGCCGAGCCTCGTCCGCCGCACCTCCCCAAGGCCGGCACCTCCATATGGGGCACCGCC
TTCGACGACGAGATCCGCCCGTCGCTGACGCACGCCTCACGCGGCATCCTCTCCATGGCTAACAAGGGTCCCGCC
ACCAATGGCTCGCAGTTCTTCATAACCTTCGACAAGGCGCCCCATCTAGACGGCCTCAATACCGTCTTCGGGAAG
CTCATTGGCGACGAGGCTCTCGTTACGCTGGCCAGCATCGAGGCTTTCCCTGTCGATGCCAAGAATCGCCCCAAG
GAGCCGCTCCGCATTGAACGCGTCACCATTCATGCGAACCCTCTGGCCGGCTGA
Gene >Ophio5|4623
ATGTCCGTCACGCTGCACACCACCGTTGGCGACCTCAAGCTTGAAGTCTTTTGTGAGAGCGTACCAAAGACCGCC
GAGGCAGGCATCCTCAGACACCATTCCACCATCACTATTACCACATCTTCACGCTGACCCGTCCATCTCGCAGAA
CTTCCTCGCCCTCTGCGCCTCCGGCTATTACGATGGCTCGCCCTTCCATCGCCTCATTCCCCAGTTCATGGCCCA
AACCGGCGCGCCCGCCGAGCCTCGTCCGCCGCACCTCCCCAAGGCCGGCACCTCCATATGGGGCACCGCCTTCGA
CGACGAGATCCGCCCGTCGCTGACGCACGCCTCACGCGGCATCCTCTCCATGGCTAACAAGGGTCCCGCCACCAA
TGGCTCGCAGTTCTTCATAACCTTCGACAAGGCGCCCCATCTAGACGGCCTCAATACCGTCTTCGGGAAGCTCAT
TGGCGACGAGGCTCTCGTTACGCTGGCCAGCATCGAGGCTTTCCCTGTCGATGCCAAGAATCGCCCCAAGGAGCC
GCTCCGCATTGAACGCGTCACCATTCATGCGAACCCTCTGGCCGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail