Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4599
Gene name
Locationscaffold_366:18675..20578
Strand-
Gene length (bp)1903
Transcript length (bp)1686
Coding sequence length (bp)1683
Protein length (aa) 561

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11787 Aft1_HRR Aft1 HRR domain 9.1E-28 203 282
PF11786 Aft1_HRA Aft1 HRA domain 2.8E-24 126 197
PF11785 Aft1_OSA Aft1 osmotic stress response (OSM) domain 1.9E-20 45 103
PF00170 bZIP_1 bZIP transcription factor 2.8E-12 449 505
PF07716 bZIP_2 Basic region leucine zipper 3.4E-05 455 499

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P52890|ATF1_SCHPO Transcription factor atf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atf1 PE=1 SV=1 445 517 7.0E-31
sp|Q5R9C9|ATF7_PONAB Cyclic AMP-dependent transcription factor ATF-7 OS=Pongo abelii GN=ATF7 PE=2 SV=1 438 519 2.0E-20
sp|P17544|ATF7_HUMAN Cyclic AMP-dependent transcription factor ATF-7 OS=Homo sapiens GN=ATF7 PE=1 SV=2 438 519 2.0E-20
sp|Q8R0S1|ATF7_MOUSE Cyclic AMP-dependent transcription factor ATF-7 OS=Mus musculus GN=Atf7 PE=2 SV=1 438 519 3.0E-20
sp|Q00969|ATF2_RAT Cyclic AMP-dependent transcription factor ATF-2 OS=Rattus norvegicus GN=Atf2 PE=1 SV=2 447 524 6.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P52890|ATF1_SCHPO Transcription factor atf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atf1 PE=1 SV=1 445 517 7.0E-31
sp|Q5R9C9|ATF7_PONAB Cyclic AMP-dependent transcription factor ATF-7 OS=Pongo abelii GN=ATF7 PE=2 SV=1 438 519 2.0E-20
sp|P17544|ATF7_HUMAN Cyclic AMP-dependent transcription factor ATF-7 OS=Homo sapiens GN=ATF7 PE=1 SV=2 438 519 2.0E-20
sp|Q8R0S1|ATF7_MOUSE Cyclic AMP-dependent transcription factor ATF-7 OS=Mus musculus GN=Atf7 PE=2 SV=1 438 519 3.0E-20
sp|Q00969|ATF2_RAT Cyclic AMP-dependent transcription factor ATF-2 OS=Rattus norvegicus GN=Atf2 PE=1 SV=2 447 524 6.0E-20
sp|P16951|ATF2_MOUSE Cyclic AMP-dependent transcription factor ATF-2 OS=Mus musculus GN=Atf2 PE=1 SV=2 447 524 6.0E-20
sp|O93602|ATF2_CHICK Cyclic AMP-dependent transcription factor ATF-2 OS=Gallus gallus GN=ATF2 PE=2 SV=1 438 524 9.0E-20
sp|P15336|ATF2_HUMAN Cyclic AMP-dependent transcription factor ATF-2 OS=Homo sapiens GN=ATF2 PE=1 SV=4 447 524 1.0E-19
sp|Q8K1L0|CREB5_MOUSE Cyclic AMP-responsive element-binding protein 5 OS=Mus musculus GN=Creb5 PE=2 SV=3 438 519 1.0E-18
sp|Q02930|CREB5_HUMAN Cyclic AMP-responsive element-binding protein 5 OS=Homo sapiens GN=CREB5 PE=1 SV=3 438 519 5.0E-18
sp|P78962|ATF21_SCHPO Transcription factor atf21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atf21 PE=3 SV=1 449 513 4.0E-16
sp|Q09771|ATF31_SCHPO Transcription factor atf31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atf31 PE=3 SV=1 434 517 3.0E-14
sp|Q59VR1|SKO1_CANAL Transcriptional regulator SKO1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SKO1 PE=1 SV=1 444 504 9.0E-11
sp|Q09926|PCR1_SCHPO Transcription factor pcr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pcr1 PE=1 SV=1 440 533 3.0E-09
sp|Q02100|SKO1_YEAST CRE-binding bZIP protein SKO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKO1 PE=1 SV=1 380 496 1.0E-08
sp|P17535|JUND_HUMAN Transcription factor jun-D OS=Homo sapiens GN=JUND PE=1 SV=3 437 521 6.0E-07
sp|P52909|JUND_RAT Transcription factor jun-D OS=Rattus norvegicus GN=Jund PE=1 SV=1 437 521 7.0E-07
sp|P15066|JUND_MOUSE Transcription factor jun-D OS=Mus musculus GN=Jund PE=1 SV=1 437 521 7.0E-07
sp|A7YY54|JUND_BOVIN Transcription factor jun-D OS=Bos taurus GN=JUND PE=2 SV=1 437 521 7.0E-07
sp|G5ECG2|FOS1_CAEEL Transcription factor fos-1 OS=Caenorhabditis elegans GN=fos-1 PE=1 SV=1 449 522 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0003700 DNA-binding transcription factor activity Yes
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0019222 regulation of metabolic process No
GO:0050794 regulation of cellular process No
GO:0140110 transcription regulator activity No
GO:0031323 regulation of cellular metabolic process No
GO:0065007 biological regulation No
GO:0010468 regulation of gene expression No
GO:0003674 molecular_function No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0051252 regulation of RNA metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:0009889 regulation of biosynthetic process No
GO:0050789 regulation of biological process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:2001141 regulation of RNA biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0031326 regulation of cellular biosynthetic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2693 0.9677 0.1209 0.0201 0.1262 0.0013 0.0479 0.0128 0.0136 0.0023

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
bZIP

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1718
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3602
Ophiocordyceps australis map64 (Brazil) OphauB2|5275
Ophiocordyceps camponoti-floridani Ophcf2|02089
Ophiocordyceps camponoti-rufipedis Ophun1|2222
Ophiocordyceps kimflemingae Ophio5|4599 (this protein)
Ophiocordyceps subramaniannii Hirsu2|1546

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4599
MGTSPTIASARGPSKSPKLSNNKPSRQDPSSDAKTESAGKLEGSSNAEVAKPLAPPPRPGQPQQAPGGTNTPDFF
APQVGGSLSLEPNPFEQSFGGGGGPETPGGTKLPPVAALTSPSSLLPGSNATPFNWGGGSLRTGPLSPAMLSGPA
NDYFSDAHHLRGGFPTPNESSLRSGLTPGGSGSMFPAPSPNSQALFAQLASGGATPNTLDFHRTALSAAAKRDQT
GNSSQQQPQQQPPTSTSQPQEISNGTSAAKAETKSATGPFDPHDNDAANGLFMLAQGAQGRAGAQNAGHFPPAAV
PTPAPAPAPAPAAVPVPSTIHAHPAHPTHSTPTTTQNQEMTPQFSNNHPASIDSGRAGSDNSNMSEDGPPLKPNI
KGKGKRNSLSTNGRRKADDVPVKAPANKRGKGNNGLVNGSLGTSDEDEDDDDDDDLKSKLEDGGGKSKMTDEEKR
KNFLERNRVAALKCRQRKKQWLANLQNKVELFSSENDALTAQITQLREEVVNLKTLLLAHKDCPVTQQQGIHGAF
MSQMEPYNAQINPYGMAGPMPNQQVMAGQSVQRRYS
Coding >Ophio5|4599
ATGGGGACTTCTCCCACTATCGCTTCCGCCCGAGGCCCGTCCAAGTCTCCTAAGCTCTCGAACAATAAGCCCTCG
CGACAAGATCCTTCCTCCGACGCGAAGACCGAATCTGCGGGCAAGCTCGAGGGCTCGTCCAATGCCGAAGTTGCC
AAGCCGCTTGCGCCGCCGCCACGACCCGGTCAACCGCAGCAGGCGCCGGGAGGAACCAATACGCCAGATTTTTTT
GCGCCCCAGGTCGGAGGATCTCTCAGTCTGGAGCCCAATCCATTCGAGCAGTCATTTGGGGGTGGAGGAGGACCC
GAAACTCCTGGAGGAACGAAGCTTCCTCCTGTGGCCGCGCTGACCTCGCCGTCATCGCTGCTTCCTGGGAGCAAC
GCCACTCCCTTTAACTGGGGCGGAGGCTCGTTGCGCACCGGACCATTGAGTCCTGCCATGTTGTCGGGGCCGGCC
AACGATTACTTCAGTGACGCCCATCATCTGCGAGGCGGCTTCCCCACCCCCAACGAATCTTCATTAAGGTCCGGA
CTTACTCCCGGCGGTAGCGGGTCCATGTTTCCTGCACCGAGTCCCAACTCTCAAGCTCTCTTTGCTCAACTCGCC
AGCGGCGGCGCTACCCCAAATACCCTCGATTTCCATCGCACCGCCCTCAGCGCCGCCGCCAAACGCGATCAGACG
GGCAACAGCAGCCAGCAGCAACCTCAGCAGCAACCGCCGACGTCGACTTCACAGCCGCAGGAGATATCGAACGGC
ACGTCGGCAGCCAAAGCAGAAACGAAATCTGCCACGGGACCATTCGATCCACACGACAACGACGCTGCAAACGGG
CTCTTCATGCTCGCTCAAGGAGCCCAGGGTCGAGCCGGAGCCCAAAACGCCGGCCATTTCCCTCCTGCCGCAGTC
CCGACTCCTGCGCCGGCGCCGGCGCCGGCACCGGCCGCAGTTCCAGTCCCCAGCACCATTCACGCGCACCCCGCG
CATCCCACACACTCCACGCCCACGACGACGCAGAACCAAGAAATGACTCCGCAATTTTCCAACAACCACCCCGCA
TCGATAGATTCGGGCCGGGCTGGCAGCGATAATAGCAATATGTCGGAAGACGGCCCACCGTTGAAGCCAAACATC
AAAGGCAAGGGCAAGAGGAACAGCCTGAGCACAAATGGCAGGAGGAAAGCGGACGATGTGCCAGTGAAAGCGCCG
GCCAACAAGAGAGGAAAGGGCAACAACGGTCTCGTCAATGGTAGCCTGGGCACGTCCGACGAAGATGAGGATGAC
GACGACGACGACGATCTCAAGTCCAAGCTGGAAGACGGAGGTGGCAAGTCTAAGATGACGGACGAGGAGAAGCGT
AAGAATTTTCTCGAGAGAAATCGTGTGGCGGCTCTTAAATGTCGACAGCGGAAAAAACAGTGGCTCGCAAATCTC
CAAAACAAAGTGGAGTTGTTCAGCTCCGAGAACGATGCGTTGACGGCGCAGATTACGCAGCTGCGGGAAGAGGTG
GTCAACCTAAAGACGCTTCTTCTGGCTCATAAAGACTGTCCTGTGACCCAACAACAAGGGATACACGGCGCCTTT
ATGTCACAAATGGAGCCATACAACGCCCAGATCAACCCGTATGGCATGGCCGGTCCCATGCCCAATCAACAGGTC
ATGGCCGGCCAGAGTGTGCAGCGTCGATATTCC
Transcript >Ophio5|4599
ATGGGGACTTCTCCCACTATCGCTTCCGCCCGAGGCCCGTCCAAGTCTCCTAAGCTCTCGAACAATAAGCCCTCG
CGACAAGATCCTTCCTCCGACGCGAAGACCGAATCTGCGGGCAAGCTCGAGGGCTCGTCCAATGCCGAAGTTGCC
AAGCCGCTTGCGCCGCCGCCACGACCCGGTCAACCGCAGCAGGCGCCGGGAGGAACCAATACGCCAGATTTTTTT
GCGCCCCAGGTCGGAGGATCTCTCAGTCTGGAGCCCAATCCATTCGAGCAGTCATTTGGGGGTGGAGGAGGACCC
GAAACTCCTGGAGGAACGAAGCTTCCTCCTGTGGCCGCGCTGACCTCGCCGTCATCGCTGCTTCCTGGGAGCAAC
GCCACTCCCTTTAACTGGGGCGGAGGCTCGTTGCGCACCGGACCATTGAGTCCTGCCATGTTGTCGGGGCCGGCC
AACGATTACTTCAGTGACGCCCATCATCTGCGAGGCGGCTTCCCCACCCCCAACGAATCTTCATTAAGGTCCGGA
CTTACTCCCGGCGGTAGCGGGTCCATGTTTCCTGCACCGAGTCCCAACTCTCAAGCTCTCTTTGCTCAACTCGCC
AGCGGCGGCGCTACCCCAAATACCCTCGATTTCCATCGCACCGCCCTCAGCGCCGCCGCCAAACGCGATCAGACG
GGCAACAGCAGCCAGCAGCAACCTCAGCAGCAACCGCCGACGTCGACTTCACAGCCGCAGGAGATATCGAACGGC
ACGTCGGCAGCCAAAGCAGAAACGAAATCTGCCACGGGACCATTCGATCCACACGACAACGACGCTGCAAACGGG
CTCTTCATGCTCGCTCAAGGAGCCCAGGGTCGAGCCGGAGCCCAAAACGCCGGCCATTTCCCTCCTGCCGCAGTC
CCGACTCCTGCGCCGGCGCCGGCGCCGGCACCGGCCGCAGTTCCAGTCCCCAGCACCATTCACGCGCACCCCGCG
CATCCCACACACTCCACGCCCACGACGACGCAGAACCAAGAAATGACTCCGCAATTTTCCAACAACCACCCCGCA
TCGATAGATTCGGGCCGGGCTGGCAGCGATAATAGCAATATGTCGGAAGACGGCCCACCGTTGAAGCCAAACATC
AAAGGCAAGGGCAAGAGGAACAGCCTGAGCACAAATGGCAGGAGGAAAGCGGACGATGTGCCAGTGAAAGCGCCG
GCCAACAAGAGAGGAAAGGGCAACAACGGTCTCGTCAATGGTAGCCTGGGCACGTCCGACGAAGATGAGGATGAC
GACGACGACGACGATCTCAAGTCCAAGCTGGAAGACGGAGGTGGCAAGTCTAAGATGACGGACGAGGAGAAGCGT
AAGAATTTTCTCGAGAGAAATCGTGTGGCGGCTCTTAAATGTCGACAGCGGAAAAAACAGTGGCTCGCAAATCTC
CAAAACAAAGTGGAGTTGTTCAGCTCCGAGAACGATGCGTTGACGGCGCAGATTACGCAGCTGCGGGAAGAGGTG
GTCAACCTAAAGACGCTTCTTCTGGCTCATAAAGACTGTCCTGTGACCCAACAACAAGGGATACACGGCGCCTTT
ATGTCACAAATGGAGCCATACAACGCCCAGATCAACCCGTATGGCATGGCCGGTCCCATGCCCAATCAACAGGTC
ATGGCCGGCCAGAGTGTGCAGCGTCGATATTCCTAG
Gene >Ophio5|4599
ATGGGGACTTCTCCCACTATCGCTTCCGCCCGAGGCCCGTCCAAGTCTCCTAAGCTCTCGAACAATAAGCCCTCG
CGACAAGGTGAGCCTCATTGTTCCCTCCTTATCCCCACCCACCTATCAGCGCCTAGTCGCCACAGCCCCCCAAAT
CAACCAATTTTCGTCTATCCCATCGTCATCTTCCCACTCGTGCTGCAGCACACGAGCATCTGGATTTGGTGTCGT
TTCTCACTGACAGCACAGATCCTTCCTCCGACGCGAAGACCGAATCTGCGGGCAAGCTCGAGGGCTCGTCCAATG
CCGAAGTTGCCAAGCCGCTTGCGCCGCCGCCACGACCCGGTCAACCGCAGCAGGCGCCGGGAGGAACCAATACGC
CAGATTTTTTTGCGCCCCAGGTCGGAGGATCTCTCAGTCTGGAGCCCAATCCATTCGAGCAGTCATTTGGGGGTG
GAGGAGGACCCGAAACTCCTGGAGGAACGAAGCTTCCTCCTGTGGCCGCGCTGACCTCGCCGTCATCGCTGCTTC
CTGGGAGCAACGCCACTCCCTTTAACTGGGGCGGAGGCTCGTTGCGCACCGGACCATTGAGTCCTGCCATGTTGT
CGGGGCCGGCCAACGATTACTTCAGTGACGCCCATCATCTGCGAGGCGGCTTCCCCACCCCCAACGAATCTTCAT
TAAGGTCCGGACTTACTCCCGGCGGTAGCGGGTCCATGTTTCCTGCACCGAGTCCCAACTCTCAAGCTCTCTTTG
CTCAACTCGCCAGCGGCGGCGCTACCCCAAATACCCTCGATTTCCATCGCACCGCCCTCAGCGCCGCCGCCAAAC
GCGATCAGACGGGCAACAGCAGCCAGCAGCAACCTCAGCAGCAACCGCCGACGTCGACTTCACAGCCGCAGGAGA
TATCGAACGGCACGTCGGCAGCCAAAGCAGAAACGAAATCTGCCACGGGACCATTCGATCCACACGACAACGACG
CTGCAAACGGGCTCTTCATGCTCGCTCAAGGAGCCCAGGGTCGAGCCGGAGCCCAAAACGCCGGCCATTTCCCTC
CTGCCGCAGTCCCGACTCCTGCGCCGGCGCCGGCGCCGGCACCGGCCGCAGTTCCAGTCCCCAGCACCATTCACG
CGCACCCCGCGCATCCCACACACTCCACGCCCACGACGACGCAGAACCAAGAAATGACTCCGCAATTTTCCAACA
ACCACCCCGCATCGATAGATTCGGGCCGGGCTGGCAGCGATAATAGCAATATGTCGGAAGACGGCCCACCGTTGA
AGCCAAACATCAAAGGCAAGGGCAAGAGGAACAGCCTGAGCACAAATGGCAGGAGGAAAGCGGACGATGTGCCAG
TGAAAGCGCCGGCCAACAAGAGAGGAAAGGGCAACAACGGTCTCGTCAATGGTAGCCTGGGCACGTCCGACGAAG
ATGAGGATGACGACGACGACGACGATCTCAAGTCCAAGCTGGAAGACGGAGGTGGCAAGTCTAAGATGACGGACG
AGGAGAAGCGTAAGAATTTTCTCGAGAGAAATCGGTAGGTCTTGGCCTTCCCGCGTCGGCAAAAACGTCTGCTGA
CACGGAGCCCTGCAGTGTGGCGGCTCTTAAATGTCGACAGCGGAAAAAACAGTGGCTCGCAAATCTCCAAAACAA
AGTGGAGTTGTTCAGCTCCGAGAACGATGCGTTGACGGCGCAGATTACGCAGCTGCGGGAAGAGGTGGTCAACCT
AAAGACGCTTCTTCTGGCTCATAAAGACTGTCCTGTGACCCAACAACAAGGGATACACGGCGCCTTTATGTCACA
AATGGAGCCATACAACGCCCAGATCAACCCGTATGGCATGGCCGGTCCCATGCCCAATCAACAGGTCATGGCCGG
CCAGAGTGTGCAGCGTCGATATTCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail