Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4598
Gene name
Locationscaffold_366:15953..17761
Strand-
Gene length (bp)1808
Transcript length (bp)1590
Coding sequence length (bp)1587
Protein length (aa) 529

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08202 MIS13 Mis12-Mtw1 protein family 4.7E-56 219 520

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9UUB5|MIS13_SCHPO Kinetochore protein mis13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mis13 PE=1 SV=1 191 384 2.0E-26

GO

GO Term Description Terminal node
GO:0000444 MIS12/MIND type complex Yes
GO:0051301 cell division Yes
GO:0007059 chromosome segregation Yes
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0032991 protein-containing complex No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4598
MTTLVATETLHLSMSGQQKRRTSKRLAAAADLEEDDDFQFVRKSKRPKTEEQESSKPVKKGGRKARATRESDVAS
VAETPRATQAASGSRRSSRKRTSGDAEAEALPTMRRATRHSKRLSGDAAEEVKGNGAVDEMRPKSSSRSGNKDAK
NRRASRSGNDETLARTTSRSNNDNNEVKTNGASRSSNKSRGTKTKAASVQSPPQQPSTTATELATTIALPMSDTP
VINRNKEMRRKGSSSRRSSLGSRGRRASSLIDNGQAAIPHREVDSADFYKHITADGLPEPRRMKQLLMWCGERAL
SGKPPHGTPDSNAILGARAIQDQLLKDFASKSEFSDWFSRDEDEPKPHVVLKPNPRNAELDEKMAALEAKIARLQ
EEKQAWLAMRKPPPDLPPLFPDDDDDDDDDSAPTTTDALTLPDFDLLDSDDGAVGRFLADPEQSFSAARTRTEEQ
LREMQASLALQVDELADSVHKLEQRVLVAGDEAALVLRLGAVRLREREERERERAGTREMPVSKVLRSLGRMLPE
GSGG
Coding >Ophio5|4598
ATGACGACTCTCGTGGCGACTGAGACGCTGCACTTGAGTATGAGCGGACAGCAGAAGCGGCGGACGAGCAAGAGG
CTTGCGGCCGCGGCGGACCTGGAAGAGGACGACGACTTTCAGTTTGTTCGCAAGTCGAAGCGGCCAAAGACGGAA
GAGCAGGAGTCGTCGAAACCGGTCAAGAAGGGCGGCCGCAAGGCAAGGGCTACGCGGGAGTCGGATGTGGCGAGC
GTCGCCGAGACGCCTCGCGCTACACAAGCTGCGTCCGGGTCGAGGAGGTCGTCGAGGAAGAGGACGAGTGGAGAT
GCGGAGGCTGAGGCGTTACCGACGATGAGGCGCGCTACGAGGCACAGCAAGCGTCTTTCTGGTGATGCGGCTGAG
GAGGTCAAGGGCAATGGCGCGGTTGACGAGATGCGCCCTAAGAGCTCGTCGCGAAGTGGCAACAAGGATGCTAAG
AACAGGCGCGCGTCACGCAGCGGAAACGACGAGACTCTGGCCAGAACGACTTCGCGCAGCAACAACGACAATAAC
GAGGTGAAAACCAACGGCGCGTCGCGCAGCAGCAACAAGAGCCGCGGCACCAAGACGAAGGCTGCCTCCGTTCAG
TCGCCGCCCCAGCAGCCATCAACAACAGCTACAGAGCTGGCGACGACGATCGCGCTGCCGATGAGCGACACGCCC
GTCATCAACCGCAACAAGGAGATGCGCAGAAAGGGATCGTCCAGCCGACGAAGCAGCCTAGGCTCGCGCGGCCGC
CGGGCCAGCTCGCTCATCGATAATGGCCAGGCGGCGATCCCCCATCGCGAGGTAGATTCGGCCGACTTCTACAAG
CACATCACGGCCGACGGGCTGCCGGAGCCGCGGCGGATGAAGCAGCTGCTCATGTGGTGCGGCGAGCGCGCCCTC
TCCGGAAAGCCGCCGCATGGCACACCCGACTCGAACGCGATTCTTGGCGCTCGCGCGATACAGGACCAGCTGCTC
AAGGACTTTGCCTCCAAGTCGGAGTTCTCGGACTGGTTCAGCAGAGACGAGGATGAGCCCAAGCCCCACGTTGTG
TTGAAGCCGAATCCGCGGAACGCCGAGCTTGATGAGAAGATGGCGGCGCTTGAGGCCAAGATTGCGAGACTACAA
GAGGAGAAACAGGCATGGCTGGCGATGCGCAAGCCGCCGCCCGACCTCCCACCGCTCTTCCCCGACGACGACGAC
GACGACGACGACGACTCGGCTCCGACGACGACCGACGCCCTGACGCTACCCGACTTTGACCTCCTAGATTCCGAC
GACGGCGCCGTCGGACGCTTCCTCGCCGACCCGGAGCAATCGTTTTCGGCGGCGCGGACGCGGACTGAGGAGCAG
CTGCGGGAGATGCAGGCCTCGCTGGCGCTGCAGGTGGACGAGCTGGCGGACAGCGTGCACAAGCTGGAGCAGCGG
GTGCTGGTAGCGGGCGACGAGGCGGCCCTGGTGCTACGGCTGGGGGCGGTGAGGCTTCGTGAGAGAGAGGAGAGG
GAGAGGGAGAGGGCGGGCACGAGGGAGATGCCTGTTTCCAAGGTGTTGAGGAGCCTGGGGAGGATGTTGCCCGAG
GGGAGTGGCGGG
Transcript >Ophio5|4598
ATGACGACTCTCGTGGCGACTGAGACGCTGCACTTGAGTATGAGCGGACAGCAGAAGCGGCGGACGAGCAAGAGG
CTTGCGGCCGCGGCGGACCTGGAAGAGGACGACGACTTTCAGTTTGTTCGCAAGTCGAAGCGGCCAAAGACGGAA
GAGCAGGAGTCGTCGAAACCGGTCAAGAAGGGCGGCCGCAAGGCAAGGGCTACGCGGGAGTCGGATGTGGCGAGC
GTCGCCGAGACGCCTCGCGCTACACAAGCTGCGTCCGGGTCGAGGAGGTCGTCGAGGAAGAGGACGAGTGGAGAT
GCGGAGGCTGAGGCGTTACCGACGATGAGGCGCGCTACGAGGCACAGCAAGCGTCTTTCTGGTGATGCGGCTGAG
GAGGTCAAGGGCAATGGCGCGGTTGACGAGATGCGCCCTAAGAGCTCGTCGCGAAGTGGCAACAAGGATGCTAAG
AACAGGCGCGCGTCACGCAGCGGAAACGACGAGACTCTGGCCAGAACGACTTCGCGCAGCAACAACGACAATAAC
GAGGTGAAAACCAACGGCGCGTCGCGCAGCAGCAACAAGAGCCGCGGCACCAAGACGAAGGCTGCCTCCGTTCAG
TCGCCGCCCCAGCAGCCATCAACAACAGCTACAGAGCTGGCGACGACGATCGCGCTGCCGATGAGCGACACGCCC
GTCATCAACCGCAACAAGGAGATGCGCAGAAAGGGATCGTCCAGCCGACGAAGCAGCCTAGGCTCGCGCGGCCGC
CGGGCCAGCTCGCTCATCGATAATGGCCAGGCGGCGATCCCCCATCGCGAGGTAGATTCGGCCGACTTCTACAAG
CACATCACGGCCGACGGGCTGCCGGAGCCGCGGCGGATGAAGCAGCTGCTCATGTGGTGCGGCGAGCGCGCCCTC
TCCGGAAAGCCGCCGCATGGCACACCCGACTCGAACGCGATTCTTGGCGCTCGCGCGATACAGGACCAGCTGCTC
AAGGACTTTGCCTCCAAGTCGGAGTTCTCGGACTGGTTCAGCAGAGACGAGGATGAGCCCAAGCCCCACGTTGTG
TTGAAGCCGAATCCGCGGAACGCCGAGCTTGATGAGAAGATGGCGGCGCTTGAGGCCAAGATTGCGAGACTACAA
GAGGAGAAACAGGCATGGCTGGCGATGCGCAAGCCGCCGCCCGACCTCCCACCGCTCTTCCCCGACGACGACGAC
GACGACGACGACGACTCGGCTCCGACGACGACCGACGCCCTGACGCTACCCGACTTTGACCTCCTAGATTCCGAC
GACGGCGCCGTCGGACGCTTCCTCGCCGACCCGGAGCAATCGTTTTCGGCGGCGCGGACGCGGACTGAGGAGCAG
CTGCGGGAGATGCAGGCCTCGCTGGCGCTGCAGGTGGACGAGCTGGCGGACAGCGTGCACAAGCTGGAGCAGCGG
GTGCTGGTAGCGGGCGACGAGGCGGCCCTGGTGCTACGGCTGGGGGCGGTGAGGCTTCGTGAGAGAGAGGAGAGG
GAGAGGGAGAGGGCGGGCACGAGGGAGATGCCTGTTTCCAAGGTGTTGAGGAGCCTGGGGAGGATGTTGCCCGAG
GGGAGTGGCGGGTAG
Gene >Ophio5|4598
ATGACGACTCTCGTGGCGACTGAGACGCTGCACTTGAGTATGAGCGGACAGCAGAAGCGGCGGACGAGCAAGAGG
CTTGCGGGTAGGCTCTCTCTCTCTCTCTCTCTCCCTCTCTTTATCTCTCTTTCTCTCTCTCTCTCTGGAAAGGGA
AAGCTAACGGCGACTTGGACGGATAGCCGCGGCGGACCTGGAAGAGGACGACGACTTTCAGTTTGTTCGCAAGTC
GAAGCGGCCAAAGACGGAAGAGCAGGAGTCGTCGAAACCGGTCAAGAAGGGCGGCCGCAAGGCAAGGGCTACGCG
GGAGTCGGATGTGGCGAGCGTCGCCGAGACGCCTCGCGCTACACAAGCTGCGTCCGGGTCGAGGAGGTCGTCGAG
GAAGAGGACGAGTGGAGATGCGGAGGCTGAGGCGTTACCGACGATGAGGCGCGCTACGAGGCACAGCAAGCGTCT
TTCTGGTGATGCGGCTGAGGAGGTCAAGGGCAATGGCGCGGTTGACGAGATGCGCCCTAAGAGCTCGTCGCGAAG
TGGCAACAAGGATGCTAAGAACAGGCGCGCGTCACGCAGCGGAAACGACGAGACTCTGGCCAGAACGACTTCGCG
CAGCAACAACGACAATAACGAGGTGAAAACCAACGGCGCGTCGCGCAGCAGCAACAAGAGCCGCGGCACCAAGAC
GAAGGCTGCCTCCGTTCAGTCGCCGCCCCAGCAGCCATCAACAACAGCTACAGAGCTGGCGACGACGATCGCGCT
GCCGATGAGCGACACGCCCGTCATCAACCGCAACAAGGAGATGCGCAGAAAGGGATCGTCCAGCCGACGAAGCAG
CCTAGGCTCGCGCGGCCGCCGGGCCAGCTCGCTCATCGATAATGGCCAGGCGGCGATCCCCCATCGCGAGGTAGA
TTCGGCCGACTTCTACAAGCACATCACGGCCGACGGGCTGCCGGAGCCGCGGCGGATGAAGCAGCTGCTCATGTG
GTGCGGCGAGCGCGCCCTCTCCGGAAAGCCGCCGCATGGCACACCCGACTCGAACGCGATTCTTGGCGGTAAGGG
CGCGTCGAGGCAAGGCGGGGCAGAGTGGCTGGCTAACGTGTTGGCTGGCAGCTCGCGCGATACAGGACCAGCTGC
TCAAGGACTTTGCCTCCAAGTCGGAGTTCTCGGACTGGTTCAGCAGAGACGAGGATGAGCCCAAGCCCCACGTTG
TGTTGAAGCCGAATCCGCGGAACGCCGAGCTTGATGAGAAGATGGCGGCGCTTGAGGCCAAGATTGCGAGGTAAG
TCTTGATTTACCATGGCAGTGGATGGTCCTAGGGCCGGCCGGCTGACAAGATTCGGCACAGACTACAAGAGGAGA
AACAGGCATGGCTGGCGATGCGCAAGCCGCCGCCCGACCTCCCACCGCTCTTCCCCGACGACGACGACGACGACG
ACGACGACTCGGCTCCGACGACGACCGACGCCCTGACGCTACCCGACTTTGACCTCCTAGATTCCGACGACGGCG
CCGTCGGACGCTTCCTCGCCGACCCGGAGCAATCGTTTTCGGCGGCGCGGACGCGGACTGAGGAGCAGCTGCGGG
AGATGCAGGCCTCGCTGGCGCTGCAGGTGGACGAGCTGGCGGACAGCGTGCACAAGCTGGAGCAGCGGGTGCTGG
TAGCGGGCGACGAGGCGGCCCTGGTGCTACGGCTGGGGGCGGTGAGGCTTCGTGAGAGAGAGGAGAGGGAGAGGG
AGAGGGCGGGCACGAGGGAGATGCCTGTTTCCAAGGTGTTGAGGAGCCTGGGGAGGATGTTGCCCGAGGGGAGTG
GCGGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail