Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4590
Gene name
Locationscaffold_366:943..2038
Strand-
Gene length (bp)1095
Transcript length (bp)954
Coding sequence length (bp)951
Protein length (aa) 317

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain 2.7E-40 5 182
PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain 2.8E-08 186 252

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HTH8|LCDH_PSEAE L-carnitine dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lcdH PE=1 SV=1 3 317 1.0E-71
sp|Q88R32|LCDH_PSEPK L-carnitine dehydrogenase OS=Pseudomonas putida (strain KT2440) GN=lcdH PE=3 SV=1 3 317 7.0E-69
sp|Q62DG4|LCDH_BURMA L-carnitine dehydrogenase OS=Burkholderia mallei (strain ATCC 23344) GN=lcdH PE=3 SV=2 3 305 1.0E-68
sp|Q93RX5|LCDH_STRCO L-carnitine dehydrogenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=lcdH PE=3 SV=1 3 310 2.0E-68
sp|B1VLT7|LCDH_STRGG L-carnitine dehydrogenase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=lcdH PE=3 SV=1 3 310 2.0E-67
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HTH8|LCDH_PSEAE L-carnitine dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lcdH PE=1 SV=1 3 317 1.0E-71
sp|Q88R32|LCDH_PSEPK L-carnitine dehydrogenase OS=Pseudomonas putida (strain KT2440) GN=lcdH PE=3 SV=1 3 317 7.0E-69
sp|Q62DG4|LCDH_BURMA L-carnitine dehydrogenase OS=Burkholderia mallei (strain ATCC 23344) GN=lcdH PE=3 SV=2 3 305 1.0E-68
sp|Q93RX5|LCDH_STRCO L-carnitine dehydrogenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=lcdH PE=3 SV=1 3 310 2.0E-68
sp|B1VLT7|LCDH_STRGG L-carnitine dehydrogenase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=lcdH PE=3 SV=1 3 310 2.0E-67
sp|Q63MT0|LCDH_BURPS L-carnitine dehydrogenase OS=Burkholderia pseudomallei (strain K96243) GN=lcdH PE=3 SV=1 3 305 2.0E-67
sp|D7B2S5|LCDH_NOCDD L-carnitine dehydrogenase OS=Nocardiopsis dassonvillei (strain ATCC 23218 / DSM 43111 / IMRU 509 / JCM 7437 / NCTC 10488) GN=lcdH PE=3 SV=1 2 304 3.0E-66
sp|D7URM0|LCDH_PSESP L-carnitine dehydrogenase OS=Pseudomonas sp. GN=lcdH PE=1 SV=1 3 317 4.0E-66
sp|Q4ZSC0|LCDH_PSEU2 L-carnitine dehydrogenase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=lcdH PE=3 SV=1 3 317 2.0E-63
sp|Q4V182|LCDH_BACCZ L-carnitine dehydrogenase OS=Bacillus cereus (strain ZK / E33L) GN=lcdH PE=3 SV=1 2 309 1.0E-61
sp|Q8CUW0|LCDH_OCEIH L-carnitine dehydrogenase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=lcdH PE=3 SV=1 3 310 2.0E-61
sp|Q8CQB9|LCDH_STAES L-carnitine dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=lcdH PE=3 SV=1 7 262 4.0E-56
sp|Q98CR3|LCDH_RHILO L-carnitine dehydrogenase OS=Rhizobium loti (strain MAFF303099) GN=lcdH PE=3 SV=1 18 307 7.0E-49
sp|D7UNT2|LCDH_RHISP L-carnitine dehydrogenase OS=Rhizobium sp. GN=lcdH PE=1 SV=1 3 307 2.0E-48
sp|Q92NF5|LCDH_RHIME L-carnitine dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=lcdH PE=3 SV=1 3 307 2.0E-47
sp|Q9Y2S2|CRYL1_HUMAN Lambda-crystallin homolog OS=Homo sapiens GN=CRYL1 PE=1 SV=3 5 255 5.0E-41
sp|Q5RDZ2|CRYL1_PONAB Lambda-crystallin homolog OS=Pongo abelii GN=CRYL1 PE=2 SV=3 5 255 6.0E-41
sp|Q5LTH8|LCDH_RUEPO L-carnitine dehydrogenase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=lcdH PE=3 SV=1 22 307 2.0E-38
sp|P14755|CRYL1_RABIT Lambda-crystallin OS=Oryctolagus cuniculus GN=CRYL1 PE=1 SV=3 6 254 1.0E-35
sp|Q99KP3|CRYL1_MOUSE Lambda-crystallin homolog OS=Mus musculus GN=Cryl1 PE=1 SV=3 6 255 4.0E-35
sp|Q8SPX7|CRYL1_BOVIN Lambda-crystallin homolog OS=Bos taurus GN=CRYL1 PE=2 SV=3 6 255 7.0E-35
sp|Q811X6|CRYL1_RAT Lambda-crystallin homolog OS=Rattus norvegicus GN=Cryl1 PE=1 SV=3 6 255 3.0E-33
sp|Q8SQ26|CRYL1_PIG Lambda-crystallin homolog OS=Sus scrofa GN=CRYL1 PE=2 SV=3 6 255 4.0E-33
sp|Q7D3B2|LCDH_AGRFC L-carnitine dehydrogenase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=lcdH PE=3 SV=2 22 304 3.0E-31
sp|P52041|HBD_CLOAB 3-hydroxybutyryl-CoA dehydrogenase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=hbd PE=1 SV=2 3 232 4.0E-22
sp|P77851|HBD_THETC 3-hydroxybutyryl-CoA dehydrogenase OS=Thermoanaerobacterium thermosaccharolyticum (strain ATCC 7956 / DSM 571 / NCIB 9385 / NCA 3814) GN=hbd PE=3 SV=2 3 232 2.0E-20
sp|Q9HZJ2|FADB_PSEAE Fatty acid oxidation complex subunit alpha OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fadB PE=3 SV=1 41 192 7.0E-19
sp|Q02PH8|FADB_PSEAB Fatty acid oxidation complex subunit alpha OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=fadB PE=3 SV=1 41 192 7.0E-19
sp|B7UYR6|FADB_PSEA8 Fatty acid oxidation complex subunit alpha OS=Pseudomonas aeruginosa (strain LESB58) GN=fadB PE=3 SV=1 41 192 7.0E-19
sp|A6V382|FADB_PSEA7 Fatty acid oxidation complex subunit alpha OS=Pseudomonas aeruginosa (strain PA7) GN=fadB PE=3 SV=1 41 192 7.0E-19
sp|A4VKA3|FADB_PSEU5 Fatty acid oxidation complex subunit alpha OS=Pseudomonas stutzeri (strain A1501) GN=fadB PE=3 SV=1 58 192 2.0E-18
sp|P45364|HBD_PEPDI 3-hydroxybutyryl-CoA dehydrogenase OS=Peptoclostridium difficile GN=hbd PE=3 SV=1 6 232 7.0E-18
sp|Q16836|HCDH_HUMAN Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Homo sapiens GN=HADH PE=1 SV=3 3 232 1.0E-17
sp|Q45223|HBD_BRADU 3-hydroxybutyryl-CoA dehydrogenase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=hbdA PE=3 SV=1 3 238 2.0E-17
sp|C3K613|FADB_PSEFS Fatty acid oxidation complex subunit alpha OS=Pseudomonas fluorescens (strain SBW25) GN=fadB PE=3 SV=1 23 192 2.0E-17
sp|P00348|HCDH_PIG Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Sus scrofa GN=HADH PE=1 SV=2 3 232 7.0E-17
sp|Q3K9D8|FADB_PSEPF Fatty acid oxidation complex subunit alpha OS=Pseudomonas fluorescens (strain Pf0-1) GN=fadB PE=3 SV=1 23 192 8.0E-17
sp|Q6FF68|FADB_ACIAD Fatty acid oxidation complex subunit alpha OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=fadB PE=3 SV=1 58 302 8.0E-17
sp|Q4KFC4|FADB_PSEF5 Fatty acid oxidation complex subunit alpha OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=fadB PE=3 SV=1 23 192 1.0E-16
sp|Q93Q12|FADB_PSEOL Fatty acid oxidation complex subunit alpha OS=Pseudomonas oleovorans GN=fadB PE=3 SV=1 58 192 1.0E-16
sp|B1J5A5|FADB_PSEPW Fatty acid oxidation complex subunit alpha OS=Pseudomonas putida (strain W619) GN=fadB PE=3 SV=1 58 192 1.0E-16
sp|Q9AHY3|FADB_PSEPU Fatty acid oxidation complex subunit alpha OS=Pseudomonas putida GN=fadB PE=3 SV=2 58 192 1.0E-16
sp|B0KH74|FADB_PSEPG Fatty acid oxidation complex subunit alpha OS=Pseudomonas putida (strain GB-1) GN=fadB PE=3 SV=1 58 192 1.0E-16
sp|Q6DAP5|FADB_PECAS Fatty acid oxidation complex subunit alpha OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fadB PE=3 SV=1 70 231 1.0E-16
sp|A4XSM8|FADB_PSEMY Fatty acid oxidation complex subunit alpha OS=Pseudomonas mendocina (strain ymp) GN=fadB PE=3 SV=1 41 192 1.0E-16
sp|P28793|FADB_PSEFR Fatty acid oxidation complex subunit alpha OS=Pseudomonas fragi GN=fadB PE=1 SV=1 23 192 1.0E-16
sp|Q61425|HCDH_MOUSE Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Mus musculus GN=Hadh PE=1 SV=2 3 232 2.0E-16
sp|B7NV20|FADB_ECO7I Fatty acid oxidation complex subunit alpha OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=fadB PE=3 SV=1 70 231 2.0E-16
sp|Q9WVK7|HCDH_RAT Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Hadh PE=2 SV=1 3 232 2.0E-16
sp|B7NFE7|FADB_ECOLU Fatty acid oxidation complex subunit alpha OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=fadB PE=3 SV=1 70 231 2.0E-16
sp|B0VE45|FADB_ACIBY Fatty acid oxidation complex subunit alpha OS=Acinetobacter baumannii (strain AYE) GN=fadB PE=3 SV=1 77 302 2.0E-16
sp|B7I3P1|FADB_ACIB5 Fatty acid oxidation complex subunit alpha OS=Acinetobacter baumannii (strain AB0057) GN=fadB PE=3 SV=1 77 302 2.0E-16
sp|B7H1I0|FADB_ACIB3 Fatty acid oxidation complex subunit alpha OS=Acinetobacter baumannii (strain AB307-0294) GN=fadB PE=3 SV=1 77 302 2.0E-16
sp|B5YY93|FADB_ECO5E Fatty acid oxidation complex subunit alpha OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=fadB PE=3 SV=1 55 231 3.0E-16
sp|Q8X8I2|FADB_ECO57 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O157:H7 GN=fadB PE=3 SV=1 55 231 3.0E-16
sp|B0VLX4|FADB_ACIBS Fatty acid oxidation complex subunit alpha OS=Acinetobacter baumannii (strain SDF) GN=fadB PE=3 SV=1 77 302 3.0E-16
sp|B2I2J9|FADB_ACIBC Fatty acid oxidation complex subunit alpha OS=Acinetobacter baumannii (strain ACICU) GN=fadB PE=3 SV=1 77 302 3.0E-16
sp|Q88L02|FADB_PSEPK Fatty acid oxidation complex subunit alpha OS=Pseudomonas putida (strain KT2440) GN=fadB PE=3 SV=1 58 192 3.0E-16
sp|A5W6H0|FADB_PSEP1 Fatty acid oxidation complex subunit alpha OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=fadB PE=3 SV=1 58 192 3.0E-16
sp|Q1I7D4|FADB_PSEE4 Fatty acid oxidation complex subunit alpha OS=Pseudomonas entomophila (strain L48) GN=fadB PE=3 SV=1 58 192 4.0E-16
sp|Q6LW06|FADB_PHOPR Fatty acid oxidation complex subunit alpha OS=Photobacterium profundum GN=fadB PE=3 SV=1 70 231 5.0E-16
sp|Q87ZB2|FADB_PSESM Fatty acid oxidation complex subunit alpha OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=fadB PE=3 SV=1 41 192 5.0E-16
sp|Q5E8X6|FADB_VIBF1 Fatty acid oxidation complex subunit alpha OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=fadB PE=3 SV=1 57 231 6.0E-16
sp|Q4ZRA0|FADB_PSEU2 Fatty acid oxidation complex subunit alpha OS=Pseudomonas syringae pv. syringae (strain B728a) GN=fadB PE=3 SV=1 41 192 6.0E-16
sp|B5FEW8|FADB_VIBFM Fatty acid oxidation complex subunit alpha OS=Vibrio fischeri (strain MJ11) GN=fadB PE=3 SV=1 57 231 1.0E-15
sp|Q87TN9|FADB_VIBPA Fatty acid oxidation complex subunit alpha OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=fadB PE=3 SV=1 70 192 2.0E-15
sp|Q48GW3|FADB_PSE14 Fatty acid oxidation complex subunit alpha OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=fadB PE=3 SV=1 41 192 2.0E-15
sp|P9WNP7|FADB2_MYCTU 3-hydroxybutyryl-CoA dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadB2 PE=1 SV=1 2 239 2.0E-15
sp|P9WNP6|FADB2_MYCTO 3-hydroxybutyryl-CoA dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadB2 PE=3 SV=1 2 239 2.0E-15
sp|Q83PG1|FADB_SHIFL Fatty acid oxidation complex subunit alpha OS=Shigella flexneri GN=fadB PE=3 SV=4 70 231 2.0E-15
sp|Q0SZ36|FADB_SHIF8 Fatty acid oxidation complex subunit alpha OS=Shigella flexneri serotype 5b (strain 8401) GN=fadB PE=3 SV=1 70 231 2.0E-15
sp|Q3YVC1|FADB_SHISS Fatty acid oxidation complex subunit alpha OS=Shigella sonnei (strain Ss046) GN=fadB PE=3 SV=1 70 231 3.0E-15
sp|P21177|FADB_ECOLI Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12) GN=fadB PE=1 SV=2 70 231 3.0E-15
sp|B1XAK8|FADB_ECODH Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12 / DH10B) GN=fadB PE=3 SV=1 70 231 3.0E-15
sp|C5A020|FADB_ECOBW Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=fadB PE=3 SV=1 70 231 3.0E-15
sp|B6EGU2|FADB_ALISL Fatty acid oxidation complex subunit alpha OS=Aliivibrio salmonicida (strain LFI1238) GN=fadB PE=3 SV=1 57 231 3.0E-15
sp|Q9KT58|FADJ_VIBCH Fatty acid oxidation complex subunit alpha OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fadJ PE=3 SV=2 78 263 4.0E-15
sp|A5F2P2|FADJ_VIBC3 Fatty acid oxidation complex subunit alpha OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=fadJ PE=3 SV=1 78 263 4.0E-15
sp|A9KU91|FADB_SHEB9 Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS195) GN=fadB PE=3 SV=1 64 192 4.0E-15
sp|A6WHA0|FADB_SHEB8 Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS185) GN=fadB PE=3 SV=1 64 192 4.0E-15
sp|B8E3R3|FADB_SHEB2 Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS223) GN=fadB PE=3 SV=1 64 192 5.0E-15
sp|A1RDW6|FADB_SHESW Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain W3-18-1) GN=fadB PE=3 SV=1 64 192 5.0E-15
sp|A4Y1B6|FADB_SHEPC Fatty acid oxidation complex subunit alpha OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=fadB PE=3 SV=1 64 192 5.0E-15
sp|A3CYJ4|FADB_SHEB5 Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=fadB PE=3 SV=1 64 192 7.0E-15
sp|A7MQP0|FADB_CROS8 Fatty acid oxidation complex subunit alpha OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=fadB PE=3 SV=1 92 231 8.0E-15
sp|A5F465|FADB_VIBC3 Fatty acid oxidation complex subunit alpha OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=fadB PE=3 SV=1 70 231 9.0E-15
sp|C3LSI3|FADB_VIBCM Fatty acid oxidation complex subunit alpha OS=Vibrio cholerae serotype O1 (strain M66-2) GN=fadB PE=3 SV=1 70 231 9.0E-15
sp|Q9KNI1|FADB_VIBCH Fatty acid oxidation complex subunit alpha OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fadB PE=3 SV=1 70 231 9.0E-15
sp|A4STF2|FADB_AERS4 Fatty acid oxidation complex subunit alpha OS=Aeromonas salmonicida (strain A449) GN=fadB PE=3 SV=1 46 192 1.0E-14
sp|P76083|PAAH_ECOLI 3-hydroxyadipyl-CoA dehydrogenase OS=Escherichia coli (strain K12) GN=paaH PE=1 SV=1 3 232 1.0E-14
sp|Q08A39|FADB_SHEFN Fatty acid oxidation complex subunit alpha OS=Shewanella frigidimarina (strain NCIMB 400) GN=fadB PE=3 SV=1 64 192 1.0E-14
sp|B5XYH0|FADB_KLEP3 Fatty acid oxidation complex subunit alpha OS=Klebsiella pneumoniae (strain 342) GN=fadB PE=3 SV=1 92 231 2.0E-14
sp|P41938|HCDH2_CAEEL Probable 3-hydroxyacyl-CoA dehydrogenase B0272.3 OS=Caenorhabditis elegans GN=B0272.3 PE=3 SV=1 3 232 2.0E-14
sp|B7VGL4|FADB_VIBTL Fatty acid oxidation complex subunit alpha OS=Vibrio tasmaniensis (strain LGP32) GN=fadB PE=3 SV=1 70 231 3.0E-14
sp|Q4FQC6|FADB_PSYA2 Fatty acid oxidation complex subunit alpha OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=fadB PE=3 SV=1 58 192 3.0E-14
sp|A7N1D2|FADB_VIBCB Fatty acid oxidation complex subunit alpha OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=fadB PE=3 SV=1 70 231 4.0E-14
sp|A6TGM4|FADB_KLEP7 Fatty acid oxidation complex subunit alpha OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=fadB PE=3 SV=1 92 231 4.0E-14
sp|Q7MZ92|FADB_PHOLL Fatty acid oxidation complex subunit alpha OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=fadB PE=3 SV=1 56 231 6.0E-14
sp|Q7N288|FADJ_PHOLL Fatty acid oxidation complex subunit alpha OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=fadJ PE=3 SV=2 39 255 8.0E-14
sp|A8ACZ4|FADB_CITK8 Fatty acid oxidation complex subunit alpha OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=fadB PE=3 SV=1 92 231 1.0E-13
sp|Q66FR8|FADB_YERPS Fatty acid oxidation complex subunit alpha OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=fadB PE=3 SV=1 70 231 2.0E-13
sp|B2K0Z6|FADB_YERPB Fatty acid oxidation complex subunit alpha OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=fadB PE=3 SV=1 70 231 2.0E-13
sp|A4WFX4|FADB_ENT38 Fatty acid oxidation complex subunit alpha OS=Enterobacter sp. (strain 638) GN=fadB PE=3 SV=1 92 231 2.0E-13
sp|Q9F0Y7|FADB_ENTCL Fatty acid oxidation complex subunit alpha OS=Enterobacter cloacae GN=fadB PE=3 SV=1 92 231 2.0E-13
sp|B0TLB9|FADB_SHEHH Fatty acid oxidation complex subunit alpha OS=Shewanella halifaxensis (strain HAW-EB4) GN=fadB PE=3 SV=1 59 192 2.0E-13
sp|A7FDF2|FADB_YERP3 Fatty acid oxidation complex subunit alpha OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=fadB PE=3 SV=1 70 231 2.0E-13
sp|B1JP63|FADB_YERPY Fatty acid oxidation complex subunit alpha OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=fadB PE=3 SV=1 70 231 2.0E-13
sp|A4TR27|FADB_YERPP Fatty acid oxidation complex subunit alpha OS=Yersinia pestis (strain Pestoides F) GN=fadB PE=3 SV=1 70 231 2.0E-13
sp|Q1CN99|FADB_YERPN Fatty acid oxidation complex subunit alpha OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=fadB PE=3 SV=1 70 231 2.0E-13
sp|A9R754|FADB_YERPG Fatty acid oxidation complex subunit alpha OS=Yersinia pestis bv. Antiqua (strain Angola) GN=fadB PE=3 SV=1 70 231 2.0E-13
sp|Q8ZAN0|FADB_YERPE Fatty acid oxidation complex subunit alpha OS=Yersinia pestis GN=fadB PE=3 SV=1 70 231 2.0E-13
sp|Q1C2C4|FADB_YERPA Fatty acid oxidation complex subunit alpha OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=fadB PE=3 SV=1 70 231 2.0E-13
sp|A7MS61|FADJ_VIBCB Fatty acid oxidation complex subunit alpha OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=fadJ PE=3 SV=1 78 200 2.0E-13
sp|Q1Q8J9|FADB_PSYCK Fatty acid oxidation complex subunit alpha OS=Psychrobacter cryohalolentis (strain K5) GN=fadB PE=3 SV=1 58 192 3.0E-13
sp|Q9ZPI6|AIM1_ARATH Peroxisomal fatty acid beta-oxidation multifunctional protein AIM1 OS=Arabidopsis thaliana GN=AIM1 PE=1 SV=1 3 241 3.0E-13
sp|B5XVW2|FADJ_KLEP3 Fatty acid oxidation complex subunit alpha OS=Klebsiella pneumoniae (strain 342) GN=fadJ PE=3 SV=1 78 207 3.0E-13
sp|Q32A21|FADB_SHIDS Fatty acid oxidation complex subunit alpha OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=fadB PE=3 SV=1 92 231 3.0E-13
sp|Q9DBM2|ECHP_MOUSE Peroxisomal bifunctional enzyme OS=Mus musculus GN=Ehhadh PE=1 SV=4 3 239 3.0E-13
sp|B2TVJ5|FADB_SHIB3 Fatty acid oxidation complex subunit alpha OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=fadB PE=3 SV=1 92 231 3.0E-13
sp|B1IW61|FADB_ECOLC Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=fadB PE=3 SV=1 92 231 3.0E-13
sp|B7M649|FADB_ECO8A Fatty acid oxidation complex subunit alpha OS=Escherichia coli O8 (strain IAI1) GN=fadB PE=3 SV=1 92 231 3.0E-13
sp|B7L9A7|FADB_ECO55 Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain 55989 / EAEC) GN=fadB PE=3 SV=1 92 231 3.0E-13
sp|B6I4I6|FADB_ECOSE Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain SE11) GN=fadB PE=3 SV=1 92 231 4.0E-13
sp|B1LM32|FADB_ECOSM Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=fadB PE=3 SV=1 92 231 4.0E-13
sp|Q0TAL0|FADB_ECOL5 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=fadB PE=3 SV=1 92 231 4.0E-13
sp|B7UNH4|FADB_ECO27 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=fadB PE=3 SV=1 92 231 4.0E-13
sp|B7LTY9|FADB_ESCF3 Fatty acid oxidation complex subunit alpha OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=fadB PE=3 SV=1 92 231 4.0E-13
sp|Q8FBI2|FADB_ECOL6 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadB PE=3 SV=2 92 231 4.0E-13
sp|A7ZU51|FADB_ECO24 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=fadB PE=3 SV=1 92 231 4.0E-13
sp|B7N2F2|FADB_ECO81 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O81 (strain ED1a) GN=fadB PE=3 SV=1 92 231 4.0E-13
sp|A1JK30|FADJ_YERE8 Fatty acid oxidation complex subunit alpha OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=fadJ PE=3 SV=2 26 283 4.0E-13
sp|Q1R466|FADB_ECOUT Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain UTI89 / UPEC) GN=fadB PE=3 SV=2 92 231 4.0E-13
sp|B7MHD1|FADB_ECO45 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=fadB PE=3 SV=1 92 231 4.0E-13
sp|A1JIG4|FADB_YERE8 Fatty acid oxidation complex subunit alpha OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=fadB PE=3 SV=1 70 231 5.0E-13
sp|Q8W1L6|MFP_ORYSJ Peroxisomal fatty acid beta-oxidation multifunctional protein OS=Oryza sativa subsp. japonica GN=MFP PE=1 SV=2 3 249 5.0E-13
sp|A8G8D1|FADB_SERP5 Fatty acid oxidation complex subunit alpha OS=Serratia proteamaculans (strain 568) GN=fadB PE=3 SV=1 70 231 9.0E-13
sp|Q87MM3|FADJ_VIBPA Fatty acid oxidation complex subunit alpha OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=fadJ PE=3 SV=1 78 200 1.0E-12
sp|Q668V1|FADJ_YERPS Fatty acid oxidation complex subunit alpha OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=fadJ PE=3 SV=2 26 255 1.0E-12
sp|A4TM82|FADJ_YERPP Fatty acid oxidation complex subunit alpha OS=Yersinia pestis (strain Pestoides F) GN=fadJ PE=3 SV=1 26 255 1.0E-12
sp|Q1CHK2|FADJ_YERPN Fatty acid oxidation complex subunit alpha OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=fadJ PE=3 SV=2 26 255 1.0E-12
sp|Q8ZD45|FADJ_YERPE Fatty acid oxidation complex subunit alpha OS=Yersinia pestis GN=fadJ PE=3 SV=2 26 255 1.0E-12
sp|Q1C660|FADJ_YERPA Fatty acid oxidation complex subunit alpha OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=fadJ PE=3 SV=2 26 255 1.0E-12
sp|A7FGK1|FADJ_YERP3 Fatty acid oxidation complex subunit alpha OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=fadJ PE=3 SV=1 26 255 1.0E-12
sp|Q8DB47|FADJ_VIBVU Fatty acid oxidation complex subunit alpha OS=Vibrio vulnificus (strain CMCP6) GN=fadJ PE=3 SV=1 78 200 1.0E-12
sp|Q7MIS5|FADJ_VIBVY Fatty acid oxidation complex subunit alpha OS=Vibrio vulnificus (strain YJ016) GN=fadJ PE=3 SV=1 78 200 1.0E-12
sp|A8A2L0|FADJ_ECOHS Fatty acid oxidation complex subunit alpha OS=Escherichia coli O9:H4 (strain HS) GN=fadJ PE=3 SV=1 3 207 2.0E-12
sp|Q0I0T3|FADB_SHESR Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain MR-7) GN=fadB PE=3 SV=1 92 192 2.0E-12
sp|Q0HPB7|FADB_SHESM Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain MR-4) GN=fadB PE=3 SV=1 92 192 2.0E-12
sp|A0KR50|FADB_SHESA Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain ANA-3) GN=fadB PE=3 SV=1 92 192 2.0E-12
sp|Q31YB7|FADJ_SHIBS Fatty acid oxidation complex subunit alpha OS=Shigella boydii serotype 4 (strain Sb227) GN=fadJ PE=3 SV=1 78 207 2.0E-12
sp|B2TWV4|FADJ_SHIB3 Fatty acid oxidation complex subunit alpha OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=fadJ PE=3 SV=1 78 207 2.0E-12
sp|Q8EKR9|FADB_SHEON Fatty acid oxidation complex subunit alpha OS=Shewanella oneidensis (strain MR-1) GN=fadB PE=3 SV=1 92 192 2.0E-12
sp|A5WH99|FADB_PSYWF Fatty acid oxidation complex subunit alpha OS=Psychrobacter sp. (strain PRwf-1) GN=fadB PE=3 SV=1 58 192 3.0E-12
sp|B7LBJ5|FADJ_ECO55 Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain 55989 / EAEC) GN=fadJ PE=3 SV=1 78 207 3.0E-12
sp|A0KEL1|FADB_AERHH Fatty acid oxidation complex subunit alpha OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=fadB PE=3 SV=1 92 192 3.0E-12
sp|B7M6M2|FADJ_ECO8A Fatty acid oxidation complex subunit alpha OS=Escherichia coli O8 (strain IAI1) GN=fadJ PE=3 SV=1 78 207 3.0E-12
sp|P77399|FADJ_ECOLI Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12) GN=fadJ PE=1 SV=1 78 207 3.0E-12
sp|B1X9L4|FADJ_ECODH Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12 / DH10B) GN=fadJ PE=3 SV=1 78 207 3.0E-12
sp|C4ZVN2|FADJ_ECOBW Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=fadJ PE=3 SV=1 78 207 3.0E-12
sp|B4TNZ1|FADB_SALSV Fatty acid oxidation complex subunit alpha OS=Salmonella schwarzengrund (strain CVM19633) GN=fadB PE=3 SV=1 92 231 3.0E-12
sp|Q9ZCZ1|FAD3_RICPR Putative fatty acid oxidation complex trifunctional enzyme OS=Rickettsia prowazekii (strain Madrid E) GN=RP560 PE=3 SV=1 3 230 4.0E-12
sp|Q29554|ECHA_PIG Trifunctional enzyme subunit alpha, mitochondrial OS=Sus scrofa GN=HADHA PE=1 SV=1 3 254 4.0E-12
sp|A8A6V1|FADB_ECOHS Fatty acid oxidation complex subunit alpha OS=Escherichia coli O9:H4 (strain HS) GN=fadB PE=3 SV=1 92 231 4.0E-12
sp|B7LLD0|FADJ_ESCF3 Fatty acid oxidation complex subunit alpha OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=fadJ PE=3 SV=1 78 207 4.0E-12
sp|B7N5V2|FADJ_ECOLU Fatty acid oxidation complex subunit alpha OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=fadJ PE=3 SV=1 78 207 4.0E-12
sp|B6I6Q4|FADJ_ECOSE Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain SE11) GN=fadJ PE=3 SV=1 78 207 5.0E-12
sp|Q68WH7|FAD3_RICTY Putative fatty acid oxidation complex trifunctional enzyme OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=RT0547 PE=3 SV=1 3 225 5.0E-12
sp|Q32DJ4|FADJ_SHIDS Fatty acid oxidation complex subunit alpha OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=fadJ PE=3 SV=1 78 207 5.0E-12
sp|B1IXA5|FADJ_ECOLC Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=fadJ PE=3 SV=1 78 207 5.0E-12
sp|A7ZPF8|FADJ_ECO24 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=fadJ PE=3 SV=1 78 207 5.0E-12
sp|B5YXY4|FADJ_ECO5E Fatty acid oxidation complex subunit alpha OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=fadJ PE=3 SV=1 78 207 5.0E-12
sp|Q8XCP2|FADJ_ECO57 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O157:H7 GN=fadJ PE=3 SV=1 78 207 5.0E-12
sp|P40939|ECHA_HUMAN Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens GN=HADHA PE=1 SV=2 3 254 5.0E-12
sp|B5BIZ0|FADB_SALPK Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi A (strain AKU_12601) GN=fadB PE=3 SV=1 92 231 6.0E-12
sp|Q5PKQ2|FADB_SALPA Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=fadB PE=3 SV=1 92 231 6.0E-12
sp|Q5QXH7|FADB_IDILO Fatty acid oxidation complex subunit alpha OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=fadB PE=3 SV=1 80 192 7.0E-12
sp|Q5E3U1|FADJ_VIBF1 Fatty acid oxidation complex subunit alpha OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=fadJ PE=3 SV=2 78 207 7.0E-12
sp|Q9L6L5|FADB_SALTY Fatty acid oxidation complex subunit alpha OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadB PE=3 SV=1 92 231 8.0E-12
sp|B5EZW0|FADB_SALA4 Fatty acid oxidation complex subunit alpha OS=Salmonella agona (strain SL483) GN=fadB PE=3 SV=1 92 231 8.0E-12
sp|A9MYB0|FADB_SALPB Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=fadB PE=3 SV=1 92 231 8.0E-12
sp|Q57HM6|FADB_SALCH Fatty acid oxidation complex subunit alpha OS=Salmonella choleraesuis (strain SC-B67) GN=fadB PE=3 SV=2 92 231 8.0E-12
sp|B5RFL6|FADB_SALG2 Fatty acid oxidation complex subunit alpha OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=fadB PE=3 SV=1 92 231 8.0E-12
sp|B5QW85|FADB_SALEP Fatty acid oxidation complex subunit alpha OS=Salmonella enteritidis PT4 (strain P125109) GN=fadB PE=3 SV=1 92 231 8.0E-12
sp|B7NP24|FADJ_ECO7I Fatty acid oxidation complex subunit alpha OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=fadJ PE=3 SV=1 78 207 1.0E-11
sp|B1LME7|FADJ_ECOSM Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=fadJ PE=3 SV=1 78 207 1.0E-11
sp|Q8FFG4|FADJ_ECOL6 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadJ PE=3 SV=1 78 207 1.0E-11
sp|B7MY16|FADJ_ECO81 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O81 (strain ED1a) GN=fadJ PE=3 SV=1 78 207 1.0E-11
sp|Q1R972|FADJ_ECOUT Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain UTI89 / UPEC) GN=fadJ PE=3 SV=1 78 207 1.0E-11
sp|A1ADI8|FADJ_ECOK1 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O1:K1 / APEC GN=fadJ PE=3 SV=1 78 207 1.0E-11
sp|B7MGV7|FADJ_ECO45 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=fadJ PE=3 SV=1 78 207 1.0E-11
sp|B7UFZ8|FADJ_ECO27 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=fadJ PE=3 SV=1 78 207 1.0E-11
sp|Q0TFA6|FADJ_ECOL5 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=fadJ PE=3 SV=1 78 207 1.0E-11
sp|Q8DDK6|FADB_VIBVU Fatty acid oxidation complex subunit alpha OS=Vibrio vulnificus (strain CMCP6) GN=fadB PE=3 SV=1 70 231 1.0E-11
sp|Q7MQH9|FADB_VIBVY Fatty acid oxidation complex subunit alpha OS=Vibrio vulnificus (strain YJ016) GN=fadB PE=3 SV=1 70 231 1.0E-11
sp|B1KCZ3|FADB_SHEWM Fatty acid oxidation complex subunit alpha OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=fadB PE=3 SV=1 92 192 1.0E-11
sp|P83589|HCDH_DEIRA Probable 3-hydroxyacyl-CoA dehydrogenase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=DR_2477 PE=1 SV=2 1 223 1.0E-11
sp|Q8Z3C6|FADB_SALTI Fatty acid oxidation complex subunit alpha OS=Salmonella typhi GN=fadB PE=3 SV=1 92 231 1.0E-11
sp|A8FP63|FADB_SHESH Fatty acid oxidation complex subunit alpha OS=Shewanella sediminis (strain HAW-EB3) GN=fadB PE=3 SV=1 92 192 1.0E-11
sp|Q3YZM2|FADJ_SHISS Fatty acid oxidation complex subunit alpha OS=Shigella sonnei (strain Ss046) GN=fadJ PE=3 SV=1 78 207 2.0E-11
sp|Q83QQ0|FADJ_SHIFL Fatty acid oxidation complex subunit alpha OS=Shigella flexneri GN=fadJ PE=3 SV=1 78 207 2.0E-11
sp|Q0T2E6|FADJ_SHIF8 Fatty acid oxidation complex subunit alpha OS=Shigella flexneri serotype 5b (strain 8401) GN=fadJ PE=3 SV=1 78 207 2.0E-11
sp|A1RI92|FADJ_SHESW Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain W3-18-1) GN=fadJ PE=3 SV=1 80 220 2.0E-11
sp|B4SZ85|FADB_SALNS Fatty acid oxidation complex subunit alpha OS=Salmonella newport (strain SL254) GN=fadB PE=3 SV=1 92 231 2.0E-11
sp|A1S7L6|FADJ_SHEAM Fatty acid oxidation complex subunit alpha OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=fadJ PE=3 SV=1 80 207 2.0E-11
sp|Q6NYL3|ECHP_DANRE Peroxisomal bifunctional enzyme OS=Danio rerio GN=ehhadh PE=2 SV=1 3 220 2.0E-11
sp|A1S1I8|FADB_SHEAM Fatty acid oxidation complex subunit alpha OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=fadB PE=3 SV=1 92 192 3.0E-11
sp|A7MH81|FADJ_CROS8 Fatty acid oxidation complex subunit alpha OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=fadJ PE=3 SV=1 78 220 3.0E-11
sp|A3D684|FADJ_SHEB5 Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=fadJ PE=3 SV=1 80 220 3.0E-11
sp|A6WQ25|FADJ_SHEB8 Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS185) GN=fadJ PE=3 SV=1 80 220 3.0E-11
sp|Q8ECP7|FADJ_SHEON Fatty acid oxidation complex subunit alpha OS=Shewanella oneidensis (strain MR-1) GN=fadJ PE=3 SV=2 80 220 3.0E-11
sp|A4Y897|FADJ_SHEPC Fatty acid oxidation complex subunit alpha OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=fadJ PE=3 SV=1 80 220 3.0E-11
sp|P07896|ECHP_RAT Peroxisomal bifunctional enzyme OS=Rattus norvegicus GN=Ehhadh PE=1 SV=2 3 239 4.0E-11
sp|A6TC19|FADJ_KLEP7 Fatty acid oxidation complex subunit alpha OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=fadJ PE=3 SV=1 78 207 4.0E-11
sp|A3QFP3|FADJ_SHELP Fatty acid oxidation complex subunit alpha OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=fadJ PE=3 SV=1 80 207 4.0E-11
sp|P45856|HBD_BACSU Probable 3-hydroxybutyryl-CoA dehydrogenase OS=Bacillus subtilis (strain 168) GN=mmgB PE=2 SV=1 1 232 4.0E-11
sp|Q0HWN3|FADJ_SHESR Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain MR-7) GN=fadJ PE=3 SV=1 80 220 6.0E-11
sp|Q9RVG1|HBD_DEIRA Probable 3-hydroxybutyryl-CoA dehydrogenase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=hbd PE=3 SV=1 7 238 6.0E-11
sp|Q0HKD1|FADJ_SHESM Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain MR-4) GN=fadJ PE=3 SV=1 80 220 6.0E-11
sp|A0KV76|FADJ_SHESA Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain ANA-3) GN=fadJ PE=3 SV=1 80 220 6.0E-11
sp|A8ADP2|FADJ_CITK8 Fatty acid oxidation complex subunit alpha OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=fadJ PE=3 SV=1 78 207 7.0E-11
sp|A8GH86|FADJ_SERP5 Fatty acid oxidation complex subunit alpha OS=Serratia proteamaculans (strain 568) GN=fadJ PE=3 SV=2 78 255 1.0E-10
sp|A3Q8U4|FADB_SHELP Fatty acid oxidation complex subunit alpha OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=fadB PE=3 SV=1 92 192 1.0E-10
sp|A8GYG0|FADB_SHEPA Fatty acid oxidation complex subunit alpha OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=fadB PE=3 SV=1 92 192 1.0E-10
sp|B8CH91|FADB_SHEPW Fatty acid oxidation complex subunit alpha OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=fadB PE=3 SV=1 92 192 2.0E-10
sp|Q5QXM1|FADJ_IDILO Fatty acid oxidation complex subunit alpha OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=fadJ PE=3 SV=1 78 207 3.0E-10
sp|A4WCW6|FADJ_ENT38 Fatty acid oxidation complex subunit alpha OS=Enterobacter sp. (strain 638) GN=fadJ PE=3 SV=1 78 219 3.0E-10
sp|Q08426|ECHP_HUMAN Peroxisomal bifunctional enzyme OS=Homo sapiens GN=EHHADH PE=1 SV=3 3 239 4.0E-10
sp|Q5R5M8|ECHP_PONAB Peroxisomal bifunctional enzyme OS=Pongo abelii GN=EHHADH PE=2 SV=1 3 239 4.0E-10
sp|C6DAL7|FADJ_PECCP Fatty acid oxidation complex subunit alpha OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=fadJ PE=3 SV=1 68 208 4.0E-10
sp|B0TL21|FADJ_SHEHH Fatty acid oxidation complex subunit alpha OS=Shewanella halifaxensis (strain HAW-EB4) GN=fadJ PE=3 SV=1 80 218 4.0E-10
sp|Q07ZP8|FADJ_SHEFN Fatty acid oxidation complex subunit alpha OS=Shewanella frigidimarina (strain NCIMB 400) GN=fadJ PE=3 SV=1 80 207 6.0E-10
sp|Q4UL32|FAD3_RICFE Putative fatty acid oxidation complex trifunctional enzyme OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0890 PE=3 SV=1 3 230 7.0E-10
sp|Q489W3|FADB_COLP3 Fatty acid oxidation complex subunit alpha OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=fadB PE=3 SV=1 80 192 8.0E-10
sp|Q6D2L7|FADJ_PECAS Fatty acid oxidation complex subunit alpha OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fadJ PE=3 SV=1 53 208 1.0E-09
sp|B5R3R9|FADJ_SALEP Fatty acid oxidation complex subunit alpha OS=Salmonella enteritidis PT4 (strain P125109) GN=fadJ PE=3 SV=1 78 207 2.0E-09
sp|B4TCA8|FADJ_SALHS Fatty acid oxidation complex subunit alpha OS=Salmonella heidelberg (strain SL476) GN=fadJ PE=3 SV=1 78 207 2.0E-09
sp|Q57LW6|FADJ_SALCH Fatty acid oxidation complex subunit alpha OS=Salmonella choleraesuis (strain SC-B67) GN=fadJ PE=3 SV=1 78 207 2.0E-09
sp|B5EZR9|FADJ_SALA4 Fatty acid oxidation complex subunit alpha OS=Salmonella agona (strain SL483) GN=fadJ PE=3 SV=1 78 207 2.0E-09
sp|B4SZR0|FADJ_SALNS Fatty acid oxidation complex subunit alpha OS=Salmonella newport (strain SL254) GN=fadJ PE=3 SV=1 78 207 2.0E-09
sp|Q8Z4Z0|FADJ_SALTI Fatty acid oxidation complex subunit alpha OS=Salmonella typhi GN=fadJ PE=3 SV=1 78 207 2.0E-09
sp|B4TQC2|FADJ_SALSV Fatty acid oxidation complex subunit alpha OS=Salmonella schwarzengrund (strain CVM19633) GN=fadJ PE=3 SV=1 78 207 2.0E-09
sp|B5BBA1|FADJ_SALPK Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi A (strain AKU_12601) GN=fadJ PE=3 SV=1 78 207 2.0E-09
sp|Q5PCX6|FADJ_SALPA Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=fadJ PE=3 SV=1 78 207 2.0E-09
sp|A9N453|FADJ_SALPB Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=fadJ PE=3 SV=1 78 207 2.0E-09
sp|Q8ZNA7|FADJ_SALTY Fatty acid oxidation complex subunit alpha OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadJ PE=3 SV=1 78 207 2.0E-09
sp|Q9ZPI5|MFP2_ARATH Peroxisomal fatty acid beta-oxidation multifunctional protein MFP2 OS=Arabidopsis thaliana GN=MFP2 PE=1 SV=1 3 207 5.0E-09
sp|Q39659|MFPA_CUCSA Glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a OS=Cucumis sativus PE=1 SV=1 3 208 5.0E-09
sp|B5FPN1|FADJ_SALDC Fatty acid oxidation complex subunit alpha OS=Salmonella dublin (strain CT_02021853) GN=fadJ PE=3 SV=1 78 207 5.0E-09
sp|B5RCL3|FADJ_SALG2 Fatty acid oxidation complex subunit alpha OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=fadJ PE=3 SV=1 78 207 5.0E-09
sp|Q6LTK3|FADJ_PHOPR Fatty acid oxidation complex subunit alpha OS=Photobacterium profundum GN=fadJ PE=3 SV=1 81 207 1.0E-08
sp|O49809|MFPA_BRANA Glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a OS=Brassica napus PE=2 SV=2 3 207 1.0E-08
sp|P55100|ECHP_CAVPO Peroxisomal bifunctional enzyme OS=Cavia porcellus GN=EHHADH PE=2 SV=2 3 239 3.0E-08
sp|O32178|FADN_BACSU Probable 3-hydroxyacyl-CoA dehydrogenase OS=Bacillus subtilis (strain 168) GN=fadN PE=2 SV=2 3 192 3.0E-08
sp|Q8BMS1|ECHA_MOUSE Trifunctional enzyme subunit alpha, mitochondrial OS=Mus musculus GN=Hadha PE=1 SV=1 3 275 1.0E-07
sp|Q64428|ECHA_RAT Trifunctional enzyme subunit alpha, mitochondrial OS=Rattus norvegicus GN=Hadha PE=1 SV=2 3 208 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0016491 oxidoreductase activity Yes
GO:0070403 NAD+ binding Yes
GO:0006631 fatty acid metabolic process Yes
GO:0044237 cellular metabolic process No
GO:0044255 cellular lipid metabolic process No
GO:0008150 biological_process No
GO:0006082 organic acid metabolic process No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0044238 primary metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0051287 NAD binding No
GO:0044281 small molecule metabolic process No
GO:0043167 ion binding No
GO:0008152 metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:0032787 monocarboxylic acid metabolic process No
GO:0036094 small molecule binding No
GO:0019752 carboxylic acid metabolic process No
GO:0006629 lipid metabolic process No
GO:0000166 nucleotide binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.7633 0.3619 0.0177 0.0781 0.3811 0.0769 0.1026 0.0774 0.0816 0.4423

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5873
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2049
Ophiocordyceps australis map64 (Brazil) OphauB2|3693
Ophiocordyceps australis map64 (Brazil) OphauB2|696
Ophiocordyceps camponoti-floridani Ophcf2|03728
Ophiocordyceps camponoti-rufipedis Ophun1|4706
Ophiocordyceps kimflemingae Ophio5|4590 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4590
MAIKTVGVIGTGVIGSSWTGLFLAHGLRVLVSDPAPDAEKKLAEYLDGIWPTMQAIGLTPGASLSNYTFVGPSMD
AHYAEVDFIQENAPEKPELKAKVIGEIDAGTRPDVVIASSSSGIPSSRFISQCTKKPGRVLIGHPFNPPHMMPLV
EVVPHPKTDETSIEKAMTFYRSIGRKPIHIRKEVPGFAANRLQAALCQEAYSLVRRGILSAQDLDDCMTNSLGPR
WAVMGPLMANAMGGGGGAEGFKHLLEHIGPGAQVWLKDMQEHDFQWDEAGINAVSVSVAEELKGKSVEALERQRD
KQLVELLGITNPKATDG
Coding >Ophio5|4590
ATGGCCATCAAGACTGTGGGTGTAATCGGCACTGGTGTCATCGGCTCATCGTGGACAGGCCTCTTTCTTGCCCAC
GGACTTCGAGTTCTGGTGTCAGACCCGGCTCCCGACGCCGAGAAGAAGCTGGCCGAGTATCTTGATGGCATATGG
CCCACCATGCAAGCTATCGGATTGACACCCGGTGCTTCGCTGTCAAACTACACCTTTGTCGGTCCCAGTATGGAC
GCTCATTACGCCGAGGTCGATTTCATTCAAGAGAATGCTCCTGAGAAACCAGAACTCAAAGCAAAAGTCATTGGA
GAAATCGACGCCGGCACGCGGCCAGACGTCGTCATAGCATCCTCCTCCTCAGGTATCCCGAGCTCGCGGTTCATC
TCCCAGTGCACGAAGAAGCCGGGCAGGGTTCTAATCGGCCATCCGTTTAACCCGCCGCACATGATGCCGCTGGTC
GAGGTAGTCCCGCACCCCAAGACGGACGAGACTAGCATCGAAAAAGCCATGACCTTCTACCGGTCCATCGGCCGC
AAGCCCATTCACATCCGCAAGGAAGTCCCGGGTTTCGCTGCCAACCGACTGCAGGCGGCCTTGTGCCAGGAAGCT
TATAGCTTGGTCAGGCGCGGCATTCTATCCGCCCAAGATCTAGATGATTGTATGACCAACAGTCTCGGGCCTCGC
TGGGCCGTCATGGGGCCGTTGATGGCAAACGCGATGGGCGGCGGCGGAGGGGCTGAAGGCTTTAAGCACCTCTTA
GAACATATAGGTCCCGGCGCCCAGGTTTGGTTGAAAGATATGCAAGAGCACGATTTTCAGTGGGACGAGGCGGGC
ATCAACGCAGTGAGCGTGAGCGTTGCCGAGGAGCTCAAGGGGAAGTCCGTTGAGGCTCTTGAGCGGCAGCGAGAT
AAGCAGCTTGTTGAGTTGCTCGGTATCACGAATCCCAAAGCAACCGATGGG
Transcript >Ophio5|4590
ATGGCCATCAAGACTGTGGGTGTAATCGGCACTGGTGTCATCGGCTCATCGTGGACAGGCCTCTTTCTTGCCCAC
GGACTTCGAGTTCTGGTGTCAGACCCGGCTCCCGACGCCGAGAAGAAGCTGGCCGAGTATCTTGATGGCATATGG
CCCACCATGCAAGCTATCGGATTGACACCCGGTGCTTCGCTGTCAAACTACACCTTTGTCGGTCCCAGTATGGAC
GCTCATTACGCCGAGGTCGATTTCATTCAAGAGAATGCTCCTGAGAAACCAGAACTCAAAGCAAAAGTCATTGGA
GAAATCGACGCCGGCACGCGGCCAGACGTCGTCATAGCATCCTCCTCCTCAGGTATCCCGAGCTCGCGGTTCATC
TCCCAGTGCACGAAGAAGCCGGGCAGGGTTCTAATCGGCCATCCGTTTAACCCGCCGCACATGATGCCGCTGGTC
GAGGTAGTCCCGCACCCCAAGACGGACGAGACTAGCATCGAAAAAGCCATGACCTTCTACCGGTCCATCGGCCGC
AAGCCCATTCACATCCGCAAGGAAGTCCCGGGTTTCGCTGCCAACCGACTGCAGGCGGCCTTGTGCCAGGAAGCT
TATAGCTTGGTCAGGCGCGGCATTCTATCCGCCCAAGATCTAGATGATTGTATGACCAACAGTCTCGGGCCTCGC
TGGGCCGTCATGGGGCCGTTGATGGCAAACGCGATGGGCGGCGGCGGAGGGGCTGAAGGCTTTAAGCACCTCTTA
GAACATATAGGTCCCGGCGCCCAGGTTTGGTTGAAAGATATGCAAGAGCACGATTTTCAGTGGGACGAGGCGGGC
ATCAACGCAGTGAGCGTGAGCGTTGCCGAGGAGCTCAAGGGGAAGTCCGTTGAGGCTCTTGAGCGGCAGCGAGAT
AAGCAGCTTGTTGAGTTGCTCGGTATCACGAATCCCAAAGCAACCGATGGGTGA
Gene >Ophio5|4590
ATGGCCATCAAGACTGTGGGTGTAATCGGCACTGGTGTCATCGGCTCATCGTGGACAGGCCTCTTTCTTGCCCAC
GGACTTCGAGTTCTGGTGTCAGACCCGGCTCCCGACGCCGAGAAGAAGCTGGCCGAGTATCTTGATGGCATATGG
CCCACCATGCAAGCTATCGGATTGACACCCGGTGCTTCGCTGTCAAACTACACCTTTGTCGGTCCCAGTATGGAC
GCTCATTACGCCGAGGTCGATTTCATTCAAGAGGTAAGCGCAGCAGGACAGGTCATCGAGTACGGCATGAAAGGC
TTTTTTATCCTAATGACGTTGATGTCACACAGAATGCTCCTGAGAAACCAGAACTCAAAGCAAAAGTCATTGGAG
AAATCGACGCCGGCACGCGGCCAGACGTCGTCATAGCATCCTCCTCCTCAGGTATCCCGAGCTCGCGGTTCATCT
CCCAGTGCACGAAGAAGCCGGGCAGGGTTCTAATCGGCCATCCGTTTAACCCGCCGCACATGATGCCGCTGGTCG
AGGTAGTCCCGCACCCCAAGACGGACGAGACTAGCATCGAAAAAGCCATGACCTTCTACCGGTCCATCGGCCGCA
AGCCCATTCACATCCGCAAGGAAGTCCCGGGTTTCGCTGCCAACCGACTGCAGGCGGCCTTGTGCCAGGAAGCTT
ATAGCTTGGTCAGGCGCGGCATTCTATCCGCCCAAGATCTAGGTCAGATCCCATGCTACTTTTCTCTTCTGCATC
GTTTCCCTCGCTAACTTATCATTCACCACCAAAGATGATTGTATGACCAACAGTCTCGGGCCTCGCTGGGCCGTC
ATGGGGCCGTTGATGGCAAACGCGATGGGCGGCGGCGGAGGGGCTGAAGGCTTTAAGCACCTCTTAGAACATATA
GGTCCCGGCGCCCAGGTTTGGTTGAAAGATATGCAAGAGCACGATTTTCAGTGGGACGAGGCGGGCATCAACGCA
GTGAGCGTGAGCGTTGCCGAGGAGCTCAAGGGGAAGTCCGTTGAGGCTCTTGAGCGGCAGCGAGATAAGCAGCTT
GTTGAGTTGCTCGGTATCACGAATCCCAAAGCAACCGATGGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail