Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4584
Gene name
Locationscaffold_365:15523..16222
Strand+
Gene length (bp)699
Transcript length (bp)603
Coding sequence length (bp)600
Protein length (aa) 200

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04900 Fcf1 Fcf1 3.9E-33 97 193
PF18477 PIN_9 PIN like domain 4.9E-10 74 176

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q05498|FCF1_YEAST rRNA-processing protein FCF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FCF1 PE=1 SV=1 1 195 1.0E-80
sp|O13610|FCF1_SCHPO rRNA-processing protein fcf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fcf1 PE=3 SV=1 1 194 5.0E-74
sp|Q5RFQ0|FCF1_PONAB rRNA-processing protein FCF1 homolog OS=Pongo abelii GN=FCF1 PE=2 SV=1 1 198 9.0E-74
sp|Q9Y324|FCF1_HUMAN rRNA-processing protein FCF1 homolog OS=Homo sapiens GN=FCF1 PE=2 SV=1 1 198 9.0E-74
sp|Q32PD0|FCF1_BOVIN rRNA-processing protein FCF1 homolog OS=Bos taurus GN=FCF1 PE=2 SV=1 1 198 9.0E-74
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q05498|FCF1_YEAST rRNA-processing protein FCF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FCF1 PE=1 SV=1 1 195 1.0E-80
sp|O13610|FCF1_SCHPO rRNA-processing protein fcf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fcf1 PE=3 SV=1 1 194 5.0E-74
sp|Q5RFQ0|FCF1_PONAB rRNA-processing protein FCF1 homolog OS=Pongo abelii GN=FCF1 PE=2 SV=1 1 198 9.0E-74
sp|Q9Y324|FCF1_HUMAN rRNA-processing protein FCF1 homolog OS=Homo sapiens GN=FCF1 PE=2 SV=1 1 198 9.0E-74
sp|Q32PD0|FCF1_BOVIN rRNA-processing protein FCF1 homolog OS=Bos taurus GN=FCF1 PE=2 SV=1 1 198 9.0E-74
sp|Q9CTH6|FCF1_MOUSE rRNA-processing protein FCF1 homolog OS=Mus musculus GN=Fcf1 PE=2 SV=2 1 198 2.0E-72
sp|Q55GM5|FCF1_DICDI rRNA-processing protein FCF1 homolog OS=Dictyostelium discoideum GN=fcf1 PE=3 SV=1 58 195 1.0E-56
sp|O74862|UTP23_SCHPO rRNA-processing protein utp23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp23 PE=3 SV=1 71 192 4.0E-13
sp|Q9BRU9|UTP23_HUMAN rRNA-processing protein UTP23 homolog OS=Homo sapiens GN=UTP23 PE=1 SV=2 61 193 2.0E-12
sp|Q08DU1|UTP23_BOVIN rRNA-processing protein UTP23 homolog OS=Bos taurus GN=UTP23 PE=2 SV=1 61 193 3.0E-12
sp|Q9CX11|UTP23_MOUSE rRNA-processing protein UTP23 homolog OS=Mus musculus GN=Utp23 PE=2 SV=1 61 193 1.0E-11
sp|Q58716|VAPC4_METJA Ribonuclease VapC4 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=vapC4 PE=3 SV=1 72 189 2.0E-08
sp|Q12339|UTP23_YEAST rRNA-processing protein UTP23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP23 PE=1 SV=1 60 197 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0032040 small-subunit processome Yes
GO:1990904 ribonucleoprotein complex No
GO:0005575 cellular_component No
GO:0032991 protein-containing complex No
GO:0030684 preribosome No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2228 0.7178 0.005 0.0898 0.3222 0.0528 0.0708 0.0096 0.0263 0.0001

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2551
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7603
Ophiocordyceps australis map64 (Brazil) OphauB2|3636
Ophiocordyceps camponoti-floridani Ophcf2|05057
Ophiocordyceps camponoti-rufipedis Ophun1|3953
Ophiocordyceps kimflemingae Ophio5|4584 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3778

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4584
MGVAKKTRKFGQVKRLLGKRDARLKANKEKAEQQVKDAAKTKKTADGELVRTVPQMPSNLFFQHNTALVPPYNVL
VDTNFLSHSVQRKLSLLESMMDCLYAKCNPIITSCVMAELEKLGPKYRLALRVARDERWQRLECDHKGVYADDCL
VDRVTKNRIYIVGTNDKALKQRLRKIPGVPLMSVARAKFVVERLPGAPES
Coding >Ophio5|4584
ATGGGTGTTGCGAAGAAAACCAGGAAATTCGGGCAGGTCAAGCGGCTCCTCGGCAAGCGCGATGCCAGACTCAAG
GCCAACAAGGAAAAGGCCGAACAGCAGGTCAAGGACGCGGCCAAGACCAAGAAAACCGCCGACGGTGAGCTAGTC
CGGACGGTGCCGCAGATGCCGAGCAACCTCTTCTTCCAGCACAACACGGCGCTGGTACCGCCCTACAACGTTCTC
GTCGACACCAACTTTCTCAGCCACAGCGTCCAGCGGAAGCTGTCGCTGCTCGAGTCTATGATGGACTGTCTTTAC
GCCAAGTGCAACCCCATCATCACCTCGTGCGTCATGGCCGAGCTCGAGAAGCTGGGCCCCAAGTATCGACTTGCG
CTGCGCGTAGCCCGTGACGAGAGATGGCAGCGCCTCGAGTGCGACCACAAGGGCGTCTACGCGGATGACTGCCTC
GTCGACAGGGTTACCAAGAATCGCATTTACATTGTCGGCACCAACGACAAGGCCCTCAAGCAGCGTCTGCGCAAA
ATCCCTGGCGTCCCACTCATGAGCGTCGCCCGTGCAAAGTTTGTCGTGGAGAGGCTGCCGGGCGCGCCCGAGTCA
Transcript >Ophio5|4584
ATGGGTGTTGCGAAGAAAACCAGGAAATTCGGGCAGGTCAAGCGGCTCCTCGGCAAGCGCGATGCCAGACTCAAG
GCCAACAAGGAAAAGGCCGAACAGCAGGTCAAGGACGCGGCCAAGACCAAGAAAACCGCCGACGGTGAGCTAGTC
CGGACGGTGCCGCAGATGCCGAGCAACCTCTTCTTCCAGCACAACACGGCGCTGGTACCGCCCTACAACGTTCTC
GTCGACACCAACTTTCTCAGCCACAGCGTCCAGCGGAAGCTGTCGCTGCTCGAGTCTATGATGGACTGTCTTTAC
GCCAAGTGCAACCCCATCATCACCTCGTGCGTCATGGCCGAGCTCGAGAAGCTGGGCCCCAAGTATCGACTTGCG
CTGCGCGTAGCCCGTGACGAGAGATGGCAGCGCCTCGAGTGCGACCACAAGGGCGTCTACGCGGATGACTGCCTC
GTCGACAGGGTTACCAAGAATCGCATTTACATTGTCGGCACCAACGACAAGGCCCTCAAGCAGCGTCTGCGCAAA
ATCCCTGGCGTCCCACTCATGAGCGTCGCCCGTGCAAAGTTTGTCGTGGAGAGGCTGCCGGGCGCGCCCGAGTCA
TAA
Gene >Ophio5|4584
ATGGGTGTTGCGAAGAAAACCAGGAAATTCGGGCAGGTGAGATAAACAACCGATGGTGGGCGGGACATACACACC
CATACACATATACATGTCCATCAAAGGCGAATGCCCCGGTTACTGACCAGCTCGCAGGTCAAGCGGCTCCTCGGC
AAGCGCGATGCCAGACTCAAGGCCAACAAGGAAAAGGCCGAACAGCAGGTCAAGGACGCGGCCAAGACCAAGAAA
ACCGCCGACGGTGAGCTAGTCCGGACGGTGCCGCAGATGCCGAGCAACCTCTTCTTCCAGCACAACACGGCGCTG
GTACCGCCCTACAACGTTCTCGTCGACACCAACTTTCTCAGCCACAGCGTCCAGCGGAAGCTGTCGCTGCTCGAG
TCTATGATGGACTGTCTTTACGCCAAGTGCAACCCCATCATCACCTCGTGCGTCATGGCCGAGCTCGAGAAGCTG
GGCCCCAAGTATCGACTTGCGCTGCGCGTAGCCCGTGACGAGAGATGGCAGCGCCTCGAGTGCGACCACAAGGGC
GTCTACGCGGATGACTGCCTCGTCGACAGGGTTACCAAGAATCGCATTTACATTGTCGGCACCAACGACAAGGCC
CTCAAGCAGCGTCTGCGCAAAATCCCTGGCGTCCCACTCATGAGCGTCGCCCGTGCAAAGTTTGTCGTGGAGAGG
CTGCCGGGCGCGCCCGAGTCATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail