Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4582
Gene name
Locationscaffold_365:13528..13904
Strand+
Gene length (bp)376
Transcript length (bp)330
Coding sequence length (bp)327
Protein length (aa) 109

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.5

Transmembrane Domains

Domain # Start End Length
1 22 44 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4582
MRSHDGAQSEEADEAAWEAAKGAAIGATKWAAGAAVLGAVAYVWSPIYRATTIQFKVYLHMSGIVFGGMIEADSR
LRQYENQVRLRRRWLREQSRWDRYQEEHAEKNDK
Coding >Ophio5|4582
ATGCGGTCCCACGACGGCGCACAGAGCGAAGAAGCCGACGAAGCCGCCTGGGAAGCGGCAAAAGGCGCCGCCATC
GGAGCCACCAAATGGGCCGCCGGCGCTGCCGTCCTCGGGGCCGTCGCCTACGTCTGGTCGCCGATATACCGCGCC
ACCACGATCCAGTTCAAAGTATACCTGCACATGTCGGGCATCGTCTTCGGGGGCATGATCGAGGCAGACTCGCGA
TTGAGGCAGTACGAGAATCAAGTGAGGCTGCGGCGCCGCTGGCTCAGGGAACAGTCGAGGTGGGACCGCTATCAA
GAGGAGCATGCCGAGAAGAACGACAAG
Transcript >Ophio5|4582
ATGCGGTCCCACGACGGCGCACAGAGCGAAGAAGCCGACGAAGCCGCCTGGGAAGCGGCAAAAGGCGCCGCCATC
GGAGCCACCAAATGGGCCGCCGGCGCTGCCGTCCTCGGGGCCGTCGCCTACGTCTGGTCGCCGATATACCGCGCC
ACCACGATCCAGTTCAAAGTATACCTGCACATGTCGGGCATCGTCTTCGGGGGCATGATCGAGGCAGACTCGCGA
TTGAGGCAGTACGAGAATCAAGTGAGGCTGCGGCGCCGCTGGCTCAGGGAACAGTCGAGGTGGGACCGCTATCAA
GAGGAGCATGCCGAGAAGAACGACAAGTGA
Gene >Ophio5|4582
ATGCGGTCCCACGACGGCGCACAGAGCGAAGAAGCCGACGAAGCCGCCTGGGAAGCGGCAAAAGGCGCCGCCATC
GGAGCCACCAAATGGGCCGCCGGCGCTGCCGTCCTCGGGGCCGTCGCCTACGTCTGGTCGCCGATATACCGCGCC
ACCACGATCCAGTTCAAAGTGTGAGAAGCCGACTACGACAAAGCGGCCGCCGCTTATTCTCGGCAGATACCTGCA
CATGTCGGGCATCGTCTTCGGGGGCATGATCGAGGCAGACTCGCGATTGAGGCAGTACGAGAATCAAGTGAGGCT
GCGGCGCCGCTGGCTCAGGGAACAGTCGAGGTGGGACCGCTATCAAGAGGAGCATGCCGAGAAGAACGACAAGTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail