Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4581
Gene name
Locationscaffold_365:10446..11570
Strand-
Gene length (bp)1124
Transcript length (bp)744
Coding sequence length (bp)741
Protein length (aa) 247

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04511 DER1 Der1-like family 4.5E-22 12 206

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9GZP9|DERL2_HUMAN Derlin-2 OS=Homo sapiens GN=DERL2 PE=1 SV=1 8 247 2.0E-20
sp|Q5RC74|DERL2_PONAB Derlin-2 OS=Pongo abelii GN=DERL2 PE=2 SV=1 8 247 2.0E-20
sp|Q8BNI4|DERL2_MOUSE Derlin-2 OS=Mus musculus GN=Derl2 PE=1 SV=2 8 247 6.0E-20
sp|Q0P5E4|DERL3_BOVIN Derlin-3 OS=Bos taurus GN=DERL3 PE=2 SV=1 9 210 5.0E-18
sp|Q96Q80|DERL3_HUMAN Derlin-3 OS=Homo sapiens GN=DERL3 PE=1 SV=2 9 210 6.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9GZP9|DERL2_HUMAN Derlin-2 OS=Homo sapiens GN=DERL2 PE=1 SV=1 8 247 2.0E-20
sp|Q5RC74|DERL2_PONAB Derlin-2 OS=Pongo abelii GN=DERL2 PE=2 SV=1 8 247 2.0E-20
sp|Q8BNI4|DERL2_MOUSE Derlin-2 OS=Mus musculus GN=Derl2 PE=1 SV=2 8 247 6.0E-20
sp|Q0P5E4|DERL3_BOVIN Derlin-3 OS=Bos taurus GN=DERL3 PE=2 SV=1 9 210 5.0E-18
sp|Q96Q80|DERL3_HUMAN Derlin-3 OS=Homo sapiens GN=DERL3 PE=1 SV=2 9 210 6.0E-17
sp|Q9D8K3|DERL3_MOUSE Derlin-3 OS=Mus musculus GN=Derl3 PE=1 SV=1 8 207 1.0E-16
sp|Q4G2J4|DER21_MAIZE Derlin-2.1 OS=Zea mays GN=DER2.1 PE=2 SV=2 4 228 3.0E-12
sp|Q4G2J3|DER22_MAIZE Derlin-2.2 OS=Zea mays GN=DER2.2 PE=2 SV=1 4 228 3.0E-12
sp|Q851X7|DERL2_ORYSJ Derlin-2 OS=Oryza sativa subsp. japonica GN=DER2 PE=2 SV=1 4 228 4.0E-12
sp|Q99J56|DERL1_MOUSE Derlin-1 OS=Mus musculus GN=Derl1 PE=1 SV=1 7 208 5.0E-11
sp|Q8VZU9|DERL1_ARATH Derlin-1 OS=Arabidopsis thaliana GN=DER1 PE=2 SV=1 7 213 3.0E-10
sp|Q71SS4|DERL1_BOVIN Derlin-1 OS=Bos taurus GN=DERL1 PE=2 SV=1 7 208 4.0E-10
sp|Q9BUN8|DERL1_HUMAN Derlin-1 OS=Homo sapiens GN=DERL1 PE=1 SV=1 7 208 7.0E-10
sp|Q5R9W3|DERL1_PONAB Derlin-1 OS=Pongo abelii GN=DERL1 PE=2 SV=1 7 208 7.0E-10
sp|Q9ZS88|DER22_ARATH Derlin-2.2 OS=Arabidopsis thaliana GN=DER2.2 PE=2 SV=1 4 211 1.0E-09
sp|Q8VZ96|DER21_ARATH Derlin-2.1 OS=Arabidopsis thaliana GN=DER2.1 PE=2 SV=3 4 211 4.0E-09
sp|Q9Y7Y0|YGR8_SCHPO Uncharacterized derlin-like protein C365.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC365.08c PE=3 SV=1 4 192 1.0E-06
sp|Q06397|DERL1_ORYSJ Derlin-1 OS=Oryza sativa subsp. japonica GN=DER1 PE=2 SV=2 7 225 2.0E-06
sp|Q21997|DERL2_CAEEL Derlin-2 OS=Caenorhabditis elegans GN=der-2 PE=2 SV=2 6 206 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 57 79 22
3 100 122 22
4 144 166 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4581
MPDQWVEAFWRLPPVSRTMAVAVLLTSVGVYTHLIPGYWLVFHPEFLWRFPPQIWRFFTPFLLTGPELSMLFDTY
FVYSYLSQLEAGNPRFSRKEDLLWYLTFVGGTIMLLNYLSGLGFTTFLQALNLAMCYTVTQEQRGMKASLMFVTI
PAPLTPFAMVAFNLLFPNGVRNMLLQLLGLIAGHMFDYLTRIWPEFGGGRNLIMTPTFFSAAVRSLGNMSTAAAP
RGGSRGPLPDSWRTRGPGQRLG
Coding >Ophio5|4581
ATGCCAGACCAGTGGGTTGAAGCCTTTTGGCGGCTGCCGCCAGTTTCTAGGACCATGGCGGTGGCCGTGCTCCTC
ACGTCGGTCGGCGTCTATACCCACCTCATCCCCGGGTACTGGCTCGTCTTTCACCCGGAATTTCTGTGGCGGTTT
CCACCCCAGATATGGCGCTTCTTTACCCCTTTTCTCCTCACTGGGCCCGAGTTGAGCATGCTTTTCGACACGTAC
TTTGTGTACTCTTACCTCAGCCAGCTCGAGGCCGGCAACCCGCGCTTTTCCCGCAAGGAGGATCTGCTGTGGTAT
TTGACCTTCGTCGGCGGCACCATCATGTTATTGAACTACCTATCAGGTCTCGGGTTTACCACCTTTCTACAGGCG
CTTAACCTAGCCATGTGCTACACCGTGACCCAGGAACAGCGCGGCATGAAGGCGAGCCTCATGTTCGTCACCATT
CCCGCTCCCCTGACGCCTTTCGCCATGGTCGCCTTCAACCTTTTGTTTCCAAACGGTGTCCGGAACATGCTCCTG
CAGCTGCTGGGCTTGATTGCCGGGCACATGTTTGACTATTTGACTCGCATATGGCCCGAGTTTGGTGGTGGCAGA
AACTTGATAATGACTCCTACCTTTTTCTCCGCAGCGGTGCGGTCCCTGGGGAACATGTCGACAGCGGCGGCACCG
AGAGGTGGCTCAAGAGGCCCTCTACCAGACTCTTGGAGGACTCGGGGGCCCGGGCAACGGTTGGGA
Transcript >Ophio5|4581
ATGCCAGACCAGTGGGTTGAAGCCTTTTGGCGGCTGCCGCCAGTTTCTAGGACCATGGCGGTGGCCGTGCTCCTC
ACGTCGGTCGGCGTCTATACCCACCTCATCCCCGGGTACTGGCTCGTCTTTCACCCGGAATTTCTGTGGCGGTTT
CCACCCCAGATATGGCGCTTCTTTACCCCTTTTCTCCTCACTGGGCCCGAGTTGAGCATGCTTTTCGACACGTAC
TTTGTGTACTCTTACCTCAGCCAGCTCGAGGCCGGCAACCCGCGCTTTTCCCGCAAGGAGGATCTGCTGTGGTAT
TTGACCTTCGTCGGCGGCACCATCATGTTATTGAACTACCTATCAGGTCTCGGGTTTACCACCTTTCTACAGGCG
CTTAACCTAGCCATGTGCTACACCGTGACCCAGGAACAGCGCGGCATGAAGGCGAGCCTCATGTTCGTCACCATT
CCCGCTCCCCTGACGCCTTTCGCCATGGTCGCCTTCAACCTTTTGTTTCCAAACGGTGTCCGGAACATGCTCCTG
CAGCTGCTGGGCTTGATTGCCGGGCACATGTTTGACTATTTGACTCGCATATGGCCCGAGTTTGGTGGTGGCAGA
AACTTGATAATGACTCCTACCTTTTTCTCCGCAGCGGTGCGGTCCCTGGGGAACATGTCGACAGCGGCGGCACCG
AGAGGTGGCTCAAGAGGCCCTCTACCAGACTCTTGGAGGACTCGGGGGCCCGGGCAACGGTTGGGATGA
Gene >Ophio5|4581
ATGCCAGACCAGTGGGTTGAAGCCTTTTGGCGGCTGCCGCCAGTTTCTAGGCAAGTTCGTCCTCTTTCTTGCGGA
GTTCTTCGGCTGACCTTTTTTTCTCCGCTTCAGGACCATGGCGGTGGCCGTGCTCCTCACGTCGGTCGGCGTCTA
TACCCACCTCATCCCCGGGTACTGGCTCGTCTTTCACCCGGAATTTCTGTGGCGGTTTCCACCCCAGATATGGCG
CTTCTTTACCCCTTTTCTCCTCACTGGGCCCGAGTTGAGCATGCTTTTCGACACGTACTTTGTGTACTCTTACCT
CAGCCAGCTCGAGGCCGGCAACCCGCGCTTTTCCCGCAAGGAGGATCTGCTGTGGTATTTGACCTTCGTCGGCGG
CACCATCATGGTAAGCTGCCGCCATCCCTGTTACCTGTTCTTTTTTTTTTCCCGTGCAATCCGTACTCGCACCTC
TTATATCTGCCCGGGTAGTGTCGTGCTCCACTGCTATCACGGTTCCTGGAACTGAGGAAGATCAACCCTGTGCTT
CGGGCTGGCCCATCATTCGCAATCCGGGCTAGCTTGCAGTACAGGACGGTGGGATGTCTTATGGATGGCTCGTGT
GGTTCCCTATTCACTCGAGTGGTTTTATAGCTCCCTACATTCCCAGCCCTCCGACGTGGACACACGTTTCCCACG
CTACGAGGCATAAGAGGCTGACAACGCCATAGTTATTGAACTACCTATCAGGTCTCGGGTTTACCACCTTTCTAC
AGGCGCTTAACCTAGCCATGTGCTACACCGTGACCCAGGAACAGCGCGGCATGAAGGCGAGCCTCATGTTCGTCA
CCATTCCCGCTCCCCTGACGCCTTTCGCCATGGTCGCCTTCAACCTTTTGTTTCCAAACGGTGTCCGGAACATGC
TCCTGCAGCTGCTGGGCTTGATTGCCGGGCACATGTTTGACTATTTGACTCGCATATGGCCCGAGTTTGGTGGTG
GCAGAAACTTGATAATGACTCCTACCTTTTTCTCCGCAGCGGTGCGGTCCCTGGGGAACATGTCGACAGCGGCGG
CACCGAGAGGTGGCTCAAGAGGCCCTCTACCAGACTCTTGGAGGACTCGGGGGCCCGGGCAACGGTTGGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail