Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4571
Gene name
Locationscaffold_364:5286..6854
Strand+
Gene length (bp)1568
Transcript length (bp)1434
Coding sequence length (bp)1431
Protein length (aa) 477

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06423 GWT1 GWT1 2.3E-40 295 437

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SCL1|GWT1_NEUCR GPI-anchored wall transfer protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gwt1 PE=3 SV=1 5 477 0.0E+00
sp|Q2HCW8|GWT1_CHAGB GPI-anchored wall transfer protein 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=GWT1 PE=3 SV=1 6 477 0.0E+00
sp|Q4IQ08|GWT1_GIBZE GPI-anchored wall transfer protein 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=GWT1 PE=3 SV=1 1 477 0.0E+00
sp|Q873N1|GWT1_ASPFU GPI-anchored wall transfer protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gwt1 PE=3 SV=2 6 475 1.0E-167
sp|Q2UQH4|GWT1_ASPOR GPI-anchored wall transfer protein 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=gwt1 PE=3 SV=1 5 477 4.0E-167
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SCL1|GWT1_NEUCR GPI-anchored wall transfer protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gwt1 PE=3 SV=1 5 477 0.0E+00
sp|Q2HCW8|GWT1_CHAGB GPI-anchored wall transfer protein 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=GWT1 PE=3 SV=1 6 477 0.0E+00
sp|Q4IQ08|GWT1_GIBZE GPI-anchored wall transfer protein 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=GWT1 PE=3 SV=1 1 477 0.0E+00
sp|Q873N1|GWT1_ASPFU GPI-anchored wall transfer protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gwt1 PE=3 SV=2 6 475 1.0E-167
sp|Q2UQH4|GWT1_ASPOR GPI-anchored wall transfer protein 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=gwt1 PE=3 SV=1 5 477 4.0E-167
sp|Q5BF53|GWT1_EMENI GPI-anchored wall transfer protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=gwt1 PE=3 SV=1 6 477 2.0E-165
sp|Q6CAW6|GWT1_YARLI GPI-anchored wall transfer protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GWT1 PE=3 SV=1 6 477 3.0E-110
sp|Q873N2|GWT1_CANAL GPI-anchored wall transfer protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GWT1 PE=3 SV=1 6 477 5.0E-106
sp|Q754I2|GWT1_ASHGO GPI-anchored wall transfer protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GWT1 PE=3 SV=1 4 477 2.0E-104
sp|Q6FLH2|GWT1_CANGA GPI-anchored wall transfer protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GWT1 PE=3 SV=1 4 477 8.0E-97
sp|P47026|GWT1_YEAST GPI-anchored wall transfer protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GWT1 PE=1 SV=2 8 477 5.0E-96
sp|Q6BTT3|GWT1_DEBHA GPI-anchored wall transfer protein 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GWT1 PE=3 SV=2 4 477 9.0E-95
sp|Q9UTL4|GWT1_SCHPO GPI-anchored wall transfer protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gwt1 PE=1 SV=1 6 477 2.0E-75
sp|Q6CK18|GWT1_KLULA GPI-anchored wall transfer protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GWT1 PE=3 SV=1 4 457 2.0E-71
sp|Q873N0|GWT1_CRYNH GPI-anchored wall transfer protein 1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=GWT1 PE=3 SV=1 85 475 3.0E-61
sp|P0CP64|GWT1_CRYNJ GPI-anchored wall transfer protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=GWT1 PE=3 SV=1 85 475 7.0E-61
sp|P0CP65|GWT1_CRYNB GPI-anchored wall transfer protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=GWT1 PE=3 SV=1 85 475 7.0E-61
sp|Q54MC0|PIGW_DICDI Phosphatidylinositol-glycan biosynthesis class W protein OS=Dictyostelium discoideum GN=pigw PE=3 SV=2 6 477 8.0E-60
sp|B3H6K1|Y4791_ARATH Uncharacterized protein At4g17910 OS=Arabidopsis thaliana GN=At4g17910 PE=2 SV=2 104 464 7.0E-57
sp|Q7TSN4|PIGW_RAT Phosphatidylinositol-glycan biosynthesis class W protein OS=Rattus norvegicus GN=Pigw PE=1 SV=1 6 477 6.0E-56
sp|Q8C398|PIGW_MOUSE Phosphatidylinositol-glycan biosynthesis class W protein OS=Mus musculus GN=Pigw PE=2 SV=1 6 477 3.0E-51
sp|Q1LZA4|PIGW_BOVIN Phosphatidylinositol-glycan biosynthesis class W protein OS=Bos taurus GN=PIGW PE=2 SV=1 6 476 3.0E-50
sp|Q7Z7B1|PIGW_HUMAN Phosphatidylinositol-glycan biosynthesis class W protein OS=Homo sapiens GN=PIGW PE=1 SV=1 6 446 3.0E-47
[Show less]

GO

GO Term Description Terminal node
GO:0006506 GPI anchor biosynthetic process Yes
GO:0016021 integral component of membrane Yes
GO:0016746 acyltransferase activity Yes
GO:0046474 glycerophospholipid biosynthetic process No
GO:0006793 phosphorus metabolic process No
GO:0016740 transferase activity No
GO:0046488 phosphatidylinositol metabolic process No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0006650 glycerophospholipid metabolic process No
GO:0043412 macromolecule modification No
GO:1901576 organic substance biosynthetic process No
GO:0006664 glycolipid metabolic process No
GO:0006497 protein lipidation No
GO:0008654 phospholipid biosynthetic process No
GO:0006644 phospholipid metabolic process No
GO:0031224 intrinsic component of membrane No
GO:0044238 primary metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0009247 glycolipid biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0044255 cellular lipid metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0009058 biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0006661 phosphatidylinositol biosynthetic process No
GO:0090407 organophosphate biosynthetic process No
GO:0045017 glycerolipid biosynthetic process No
GO:0003824 catalytic activity No
GO:0006807 nitrogen compound metabolic process No
GO:0046467 membrane lipid biosynthetic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0006643 membrane lipid metabolic process No
GO:0008610 lipid biosynthetic process No
GO:0006505 GPI anchor metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0036211 protein modification process No
GO:0006629 lipid metabolic process No
GO:0005575 cellular_component No
GO:0019538 protein metabolic process No
GO:1903509 liposaccharide metabolic process No
GO:0009987 cellular process No
GO:0043170 macromolecule metabolic process No
GO:0046486 glycerolipid metabolic process No
GO:0110165 cellular anatomical entity No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 65 87 22
3 124 146 22
4 161 183 22
5 232 254 22
6 264 286 22
7 299 321 22
8 378 400 22
9 421 443 22
10 453 475 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4571
MADVKSYKQRKEAFVSNLSGGSVSEVAVLLWSVLQARQSFFRPYTTLGLAVDYALNVGAILLATTVYAGTPVLLD
LLLVAPAVLVYVMPNHGVRRKKARVPPPTADKEEPSKARLESLPVKPFLTTYRGCMMVVTCVAILAVDFHLFPRR
FAKVETWGTSLMDMGVGSFVFAGGVVAARPVLAERMAGRTTPLLRRLAYSARHSIPLLALGGVRLASVKGLDYAE
HVTEYGVHWNFFFTLGCLAPLVAVFHSALRIVPSYAALALLVASLYQVLLDKTALAAYILAAPRTDLISMNREGI
FSFFGYLAIFLAGQDVGMAVIPRHAAGRPPLKPTALRGLAWSGLYWLCTSYSYGLSLGVSRRLANLPYVAWVAAF
NSLQLLAFCCIDAVFFPAFYSAVGVKAEKEAYRAATSRVLRAYNRNGLAIFLVANLLTGLVNMTVRTLDAGPAMT
MGVLLAYTATVTALAVGLDAYDISIKL
Coding >Ophio5|4571
ATGGCTGACGTAAAGAGTTACAAGCAACGCAAAGAGGCCTTCGTCTCCAACCTGTCTGGCGGCTCCGTCTCCGAG
GTCGCCGTCCTGCTGTGGTCCGTCCTCCAGGCACGCCAATCCTTCTTTCGGCCCTACACGACGCTCGGCCTCGCC
GTCGACTATGCGCTCAACGTCGGTGCCATCCTGCTGGCCACGACCGTCTACGCTGGCACGCCGGTGCTGCTCGAC
CTCCTCCTTGTCGCGCCCGCCGTGCTGGTGTACGTGATGCCCAACCATGGCGTCCGCAGAAAGAAGGCTAGGGTC
CCGCCGCCGACTGCGGACAAGGAGGAGCCGTCCAAGGCGCGTCTCGAAAGCCTTCCCGTCAAGCCTTTCCTCACG
ACGTATCGCGGGTGCATGATGGTGGTGACGTGCGTGGCCATCCTCGCCGTCGATTTCCACCTCTTTCCCCGACGC
TTTGCCAAGGTCGAGACGTGGGGCACGTCGCTGATGGACATGGGCGTCGGGTCCTTTGTCTTTGCCGGTGGCGTC
GTCGCCGCAAGGCCGGTGCTTGCCGAGCGAATGGCCGGACGGACGACGCCGCTGCTGCGACGACTCGCCTACTCG
GCCCGGCACTCAATTCCGCTCCTGGCGCTGGGCGGTGTGCGGCTCGCGAGCGTCAAGGGCCTCGACTACGCCGAA
CACGTGACCGAGTACGGCGTGCACTGGAACTTCTTCTTTACGCTGGGCTGCCTTGCGCCCCTGGTGGCCGTCTTT
CACTCGGCGCTGCGCATCGTGCCGTCGTACGCGGCCTTGGCGCTGCTCGTCGCCAGCCTGTACCAGGTCCTCCTC
GACAAGACGGCGCTGGCCGCCTATATTCTCGCCGCGCCCCGGACCGATCTCATCTCCATGAACAGGGAGGGCATC
TTCAGCTTCTTCGGCTACCTGGCCATCTTTCTCGCCGGCCAAGACGTCGGCATGGCCGTCATCCCCCGCCACGCG
GCCGGACGACCTCCACTCAAGCCAACGGCGCTCCGGGGCCTGGCCTGGTCTGGGCTGTACTGGCTGTGCACCAGC
TACTCGTACGGGCTCAGCCTCGGCGTGTCGCGTCGGCTGGCCAATCTGCCGTACGTTGCCTGGGTGGCGGCCTTT
AACTCGCTGCAGCTGCTGGCCTTTTGCTGCATCGACGCCGTCTTCTTCCCGGCCTTTTACAGCGCCGTCGGCGTC
AAAGCCGAGAAGGAGGCGTACCGGGCGGCCACGAGTCGGGTGCTGCGCGCGTACAATCGCAACGGCCTCGCCATC
TTCCTCGTGGCCAACCTCTTGACGGGCCTAGTCAACATGACGGTCCGCACGCTCGACGCTGGCCCGGCCATGACC
ATGGGGGTACTACTCGCGTACACGGCGACGGTCACGGCCCTGGCTGTGGGGCTCGATGCCTACGATATCTCCATC
AAGCTG
Transcript >Ophio5|4571
ATGGCTGACGTAAAGAGTTACAAGCAACGCAAAGAGGCCTTCGTCTCCAACCTGTCTGGCGGCTCCGTCTCCGAG
GTCGCCGTCCTGCTGTGGTCCGTCCTCCAGGCACGCCAATCCTTCTTTCGGCCCTACACGACGCTCGGCCTCGCC
GTCGACTATGCGCTCAACGTCGGTGCCATCCTGCTGGCCACGACCGTCTACGCTGGCACGCCGGTGCTGCTCGAC
CTCCTCCTTGTCGCGCCCGCCGTGCTGGTGTACGTGATGCCCAACCATGGCGTCCGCAGAAAGAAGGCTAGGGTC
CCGCCGCCGACTGCGGACAAGGAGGAGCCGTCCAAGGCGCGTCTCGAAAGCCTTCCCGTCAAGCCTTTCCTCACG
ACGTATCGCGGGTGCATGATGGTGGTGACGTGCGTGGCCATCCTCGCCGTCGATTTCCACCTCTTTCCCCGACGC
TTTGCCAAGGTCGAGACGTGGGGCACGTCGCTGATGGACATGGGCGTCGGGTCCTTTGTCTTTGCCGGTGGCGTC
GTCGCCGCAAGGCCGGTGCTTGCCGAGCGAATGGCCGGACGGACGACGCCGCTGCTGCGACGACTCGCCTACTCG
GCCCGGCACTCAATTCCGCTCCTGGCGCTGGGCGGTGTGCGGCTCGCGAGCGTCAAGGGCCTCGACTACGCCGAA
CACGTGACCGAGTACGGCGTGCACTGGAACTTCTTCTTTACGCTGGGCTGCCTTGCGCCCCTGGTGGCCGTCTTT
CACTCGGCGCTGCGCATCGTGCCGTCGTACGCGGCCTTGGCGCTGCTCGTCGCCAGCCTGTACCAGGTCCTCCTC
GACAAGACGGCGCTGGCCGCCTATATTCTCGCCGCGCCCCGGACCGATCTCATCTCCATGAACAGGGAGGGCATC
TTCAGCTTCTTCGGCTACCTGGCCATCTTTCTCGCCGGCCAAGACGTCGGCATGGCCGTCATCCCCCGCCACGCG
GCCGGACGACCTCCACTCAAGCCAACGGCGCTCCGGGGCCTGGCCTGGTCTGGGCTGTACTGGCTGTGCACCAGC
TACTCGTACGGGCTCAGCCTCGGCGTGTCGCGTCGGCTGGCCAATCTGCCGTACGTTGCCTGGGTGGCGGCCTTT
AACTCGCTGCAGCTGCTGGCCTTTTGCTGCATCGACGCCGTCTTCTTCCCGGCCTTTTACAGCGCCGTCGGCGTC
AAAGCCGAGAAGGAGGCGTACCGGGCGGCCACGAGTCGGGTGCTGCGCGCGTACAATCGCAACGGCCTCGCCATC
TTCCTCGTGGCCAACCTCTTGACGGGCCTAGTCAACATGACGGTCCGCACGCTCGACGCTGGCCCGGCCATGACC
ATGGGGGTACTACTCGCGTACACGGCGACGGTCACGGCCCTGGCTGTGGGGCTCGATGCCTACGATATCTCCATC
AAGCTGTGA
Gene >Ophio5|4571
ATGGCTGACGTAAAGAGTTACAAGCAACGCAAAGAGGCCTTCGTCTCCAACCTGTCTGGCGGCTCCGTCTCCGAG
GTCGGCTTGGTGACGTCCGTGGCGCCGGCAAGTGGCCTTCGGTCCTCTTCCCACCCACACGGGGGCGTGCACACA
CCACTCTTCGACTTGCCGAGGCTCTCTTTGACGGCGGCTGACCTCGTTTTTGACAACAGGTCGCCGTCCTGCTGT
GGTCCGTCCTCCAGGCACGCCAATCCTTCTTTCGGCCCTACACGACGCTCGGCCTCGCCGTCGACTATGCGCTCA
ACGTCGGTGCCATCCTGCTGGCCACGACCGTCTACGCTGGCACGCCGGTGCTGCTCGACCTCCTCCTTGTCGCGC
CCGCCGTGCTGGTGTACGTGATGCCCAACCATGGCGTCCGCAGAAAGAAGGCTAGGGTCCCGCCGCCGACTGCGG
ACAAGGAGGAGCCGTCCAAGGCGCGTCTCGAAAGCCTTCCCGTCAAGCCTTTCCTCACGACGTATCGCGGGTGCA
TGATGGTGGTGACGTGCGTGGCCATCCTCGCCGTCGATTTCCACCTCTTTCCCCGACGCTTTGCCAAGGTCGAGA
CGTGGGGCACGTCGCTGATGGACATGGGCGTCGGGTCCTTTGTCTTTGCCGGTGGCGTCGTCGCCGCAAGGCCGG
TGCTTGCCGAGCGAATGGCCGGACGGACGACGCCGCTGCTGCGACGACTCGCCTACTCGGCCCGGCACTCAATTC
CGCTCCTGGCGCTGGGCGGTGTGCGGCTCGCGAGCGTCAAGGGCCTCGACTACGCCGAACACGTGACCGAGTACG
GCGTGCACTGGAACTTCTTCTTTACGCTGGGCTGCCTTGCGCCCCTGGTGGCCGTCTTTCACTCGGCGCTGCGCA
TCGTGCCGTCGTACGCGGCCTTGGCGCTGCTCGTCGCCAGCCTGTACCAGGTCCTCCTCGACAAGACGGCGCTGG
CCGCCTATATTCTCGCCGCGCCCCGGACCGATCTCATCTCCATGAACAGGGAGGGCATCTTCAGCTTCTTCGGCT
ACCTGGCCATCTTTCTCGCCGGCCAAGACGTCGGCATGGCCGTCATCCCCCGCCACGCGGCCGGACGACCTCCAC
TCAAGCCAACGGCGCTCCGGGGCCTGGCCTGGTCTGGGCTGTACTGGCTGTGCACCAGCTACTCGTACGGGCTCA
GCCTCGGCGTGTCGCGTCGGCTGGCCAATCTGCCGTACGTTGCCTGGGTGGCGGCCTTTAACTCGCTGCAGCTGC
TGGCCTTTTGCTGCATCGACGCCGTCTTCTTCCCGGCCTTTTACAGCGCCGTCGGCGTCAAAGCCGAGAAGGAGG
CGTACCGGGCGGCCACGAGTCGGGTGCTGCGCGCGTACAATCGCAACGGCCTCGCCATCTTCCTCGTGGCCAACC
TCTTGACGGGCCTAGTCAACATGACGGTCCGCACGCTCGACGCTGGCCCGGCCATGACCATGGGGGTACTACTCG
CGTACACGGCGACGGTCACGGCCCTGGCTGTGGGGCTCGATGCCTACGATATCTCCATCAAGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail