Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4564
Gene name
Locationscaffold_363:8938..11108
Strand+
Gene length (bp)2170
Transcript length (bp)1782
Coding sequence length (bp)1779
Protein length (aa) 593

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01375 Enterotoxin_a Heat-labile enterotoxin alpha chain 2.8E-17 36 150

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P06717|ELAP_ECOLX Heat-labile enterotoxin A chain OS=Escherichia coli GN=eltA PE=1 SV=1 30 150 3.0E-11
sp|P43530|ELAH_ECOH1 Heat-labile enterotoxin A chain OS=Escherichia coli O78:H11 (strain H10407 / ETEC) GN=eltA PE=3 SV=1 36 150 7.0E-11
sp|P01555|CHTA_VIBCH Cholera enterotoxin subunit A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ctxA PE=1 SV=1 1 150 7.0E-11
sp|A2PU44|CHELT_VIBCL NAD(+)--arginine ADP-ribosyltransferase Chelt OS=Vibrio cholerae GN=A51_B1772 PE=1 SV=1 37 174 2.0E-10
sp|P43528|E2BA_ECOLX Heat-labile enterotoxin IIB, A chain OS=Escherichia coli PE=1 SV=2 37 150 2.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P06717|ELAP_ECOLX Heat-labile enterotoxin A chain OS=Escherichia coli GN=eltA PE=1 SV=1 30 150 3.0E-11
sp|P43530|ELAH_ECOH1 Heat-labile enterotoxin A chain OS=Escherichia coli O78:H11 (strain H10407 / ETEC) GN=eltA PE=3 SV=1 36 150 7.0E-11
sp|P01555|CHTA_VIBCH Cholera enterotoxin subunit A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ctxA PE=1 SV=1 1 150 7.0E-11
sp|A2PU44|CHELT_VIBCL NAD(+)--arginine ADP-ribosyltransferase Chelt OS=Vibrio cholerae GN=A51_B1772 PE=1 SV=1 37 174 2.0E-10
sp|P43528|E2BA_ECOLX Heat-labile enterotoxin IIB, A chain OS=Escherichia coli PE=1 SV=2 37 150 2.0E-10
sp|P13810|E2AA_ECOLX Heat-labile enterotoxin IIA, A chain OS=Escherichia coli PE=3 SV=1 37 150 6.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0090729 toxin activity Yes
GO:0005615 extracellular space Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 3.13 0.84 5.42
CcL In ants, during behavior modification 59.54 25.42 93.66
CcD In ants, recently dead 59.13 32.12 86.14

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.982050 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4564
MLRLYWPQLAFLVTFLCSTLDQCLAGLPPGDRSLYVFRGDSRSPNQIEADGGFLPWPEIDYNDPRGYSLWDHVNA
QSPHSAYISTSRSFGQSAVNFANAQGFGNYVYRIHITPNMIDVNNVFPNGPYTFQNEVSALGGIPWNAVQGWLQM
PGEDSDSGVFDLDAPRFDNDLADNYTMRYETDFESRFINNPGYVTEGREGTTVRTLDDEDVATLRGGTPSERKVI
IEAAERFMNRNGRMVGWTTNQRFPLWRPQTGSVQASPPHTDGHAANTSNRKMDCPSSSSSKSQTTDQVFELDEAD
LMDIEEFLADQESKCEENSNAGNGPLRAEASAAMARAAERVEQSCQAHHEEDAWLQAALEHLREPSSNCHLFNKC
GLGLGHFKRKRSADRGPSRIRRVYKVLVCWDGNSNESCQDGSRYRYDAERKGRNVEVVDRIELLSTSAVPVCNSI
SRLKVEFHLSDRTWAGTYDALLLQFEGQTTHTPIPLTNAPRAGDSVFKDIDLKTIFGANKVPLREIKSVRLLDVP
NPNEYWAKDQWRLKGLSLQGICDPSGKAIQMTKFTSLEKPLQHGRLERKRAKAGEEGEERRASQMSVL
Coding >Ophio5|4564
ATGCTTCGACTATACTGGCCCCAACTTGCATTCCTCGTTACATTTCTCTGCTCTACCCTTGACCAATGTCTTGCG
GGATTACCACCAGGCGACCGGTCACTTTACGTTTTCCGTGGAGACTCTCGAAGCCCAAATCAGATTGAAGCAGAT
GGGGGCTTCCTCCCCTGGCCTGAAATAGACTACAATGACCCTAGAGGTTATAGTCTTTGGGATCACGTCAACGCC
CAGTCGCCGCATTCAGCCTACATATCAACCTCGAGAAGCTTCGGGCAGTCAGCCGTCAACTTCGCCAATGCACAG
GGCTTCGGAAATTACGTGTACCGCATCCATATAACTCCTAACATGATTGATGTGAACAATGTATTCCCCAATGGT
CCCTATACCTTCCAGAATGAAGTCAGTGCGTTAGGAGGCATCCCATGGAATGCGGTCCAAGGATGGTTACAGATG
CCCGGGGAAGACAGCGACTCCGGAGTATTCGATCTCGACGCTCCGCGGTTCGACAACGACTTAGCGGATAATTAC
ACGATGAGATACGAAACTGATTTCGAGTCACGATTCATTAACAACCCGGGCTATGTTACCGAAGGGCGTGAGGGG
ACTACGGTACGAACATTGGACGATGAAGATGTCGCTACTCTGAGGGGAGGAACACCAAGCGAGAGAAAAGTGATA
ATCGAAGCCGCGGAACGATTCATGAACAGAAATGGTCGAATGGTTGGGTGGACGACGAATCAGCGTTTTCCTCTG
TGGCGGCCACAAACTGGTTCCGTTCAAGCGTCGCCGCCACACACCGACGGCCATGCCGCAAACACCTCTAATAGA
AAGATGGACTGCCCTTCTTCTTCCTCGAGTAAGAGTCAAACGACGGATCAAGTTTTTGAGTTGGATGAAGCCGAT
CTCATGGACATCGAAGAATTTCTGGCCGATCAAGAGTCCAAATGCGAAGAGAATTCAAATGCAGGAAACGGCCCT
CTCAGAGCCGAGGCAAGTGCTGCCATGGCCAGAGCCGCGGAGAGAGTGGAGCAGTCCTGTCAAGCACATCATGAG
GAAGATGCATGGCTTCAGGCGGCCCTGGAGCATTTACGAGAGCCGAGCAGCAACTGCCACCTCTTCAACAAGTGT
GGCTTGGGTCTCGGGCACTTCAAGCGGAAACGATCAGCAGACCGGGGCCCATCCAGGATAAGACGGGTCTACAAG
GTGCTTGTTTGTTGGGACGGCAACTCCAACGAGAGCTGTCAAGATGGCAGCAGATATAGATACGACGCCGAACGC
AAAGGCAGGAATGTGGAAGTCGTCGACAGAATCGAACTACTCAGTACATCTGCTGTTCCAGTCTGCAACTCCATT
AGCAGGTTAAAAGTTGAGTTTCATTTATCAGACCGTACCTGGGCTGGGACATACGATGCTCTGCTGCTTCAATTC
GAGGGTCAAACGACACATACCCCTATCCCTCTCACCAACGCACCCCGTGCCGGAGACTCCGTGTTCAAAGACATT
GACCTGAAAACCATATTTGGGGCGAACAAGGTGCCATTGCGTGAGATTAAAAGCGTGCGTTTGCTGGATGTGCCC
AATCCAAACGAGTACTGGGCCAAAGATCAGTGGCGGCTCAAAGGGTTATCACTCCAGGGGATATGCGATCCTTCG
GGCAAAGCCATTCAGATGACAAAGTTTACCTCACTGGAGAAGCCTCTTCAACACGGGAGACTGGAGCGCAAAAGG
GCAAAGGCGGGTGAAGAAGGGGAAGAACGGCGGGCGTCGCAGATGTCGGTCTTG
Transcript >Ophio5|4564
ATGCTTCGACTATACTGGCCCCAACTTGCATTCCTCGTTACATTTCTCTGCTCTACCCTTGACCAATGTCTTGCG
GGATTACCACCAGGCGACCGGTCACTTTACGTTTTCCGTGGAGACTCTCGAAGCCCAAATCAGATTGAAGCAGAT
GGGGGCTTCCTCCCCTGGCCTGAAATAGACTACAATGACCCTAGAGGTTATAGTCTTTGGGATCACGTCAACGCC
CAGTCGCCGCATTCAGCCTACATATCAACCTCGAGAAGCTTCGGGCAGTCAGCCGTCAACTTCGCCAATGCACAG
GGCTTCGGAAATTACGTGTACCGCATCCATATAACTCCTAACATGATTGATGTGAACAATGTATTCCCCAATGGT
CCCTATACCTTCCAGAATGAAGTCAGTGCGTTAGGAGGCATCCCATGGAATGCGGTCCAAGGATGGTTACAGATG
CCCGGGGAAGACAGCGACTCCGGAGTATTCGATCTCGACGCTCCGCGGTTCGACAACGACTTAGCGGATAATTAC
ACGATGAGATACGAAACTGATTTCGAGTCACGATTCATTAACAACCCGGGCTATGTTACCGAAGGGCGTGAGGGG
ACTACGGTACGAACATTGGACGATGAAGATGTCGCTACTCTGAGGGGAGGAACACCAAGCGAGAGAAAAGTGATA
ATCGAAGCCGCGGAACGATTCATGAACAGAAATGGTCGAATGGTTGGGTGGACGACGAATCAGCGTTTTCCTCTG
TGGCGGCCACAAACTGGTTCCGTTCAAGCGTCGCCGCCACACACCGACGGCCATGCCGCAAACACCTCTAATAGA
AAGATGGACTGCCCTTCTTCTTCCTCGAGTAAGAGTCAAACGACGGATCAAGTTTTTGAGTTGGATGAAGCCGAT
CTCATGGACATCGAAGAATTTCTGGCCGATCAAGAGTCCAAATGCGAAGAGAATTCAAATGCAGGAAACGGCCCT
CTCAGAGCCGAGGCAAGTGCTGCCATGGCCAGAGCCGCGGAGAGAGTGGAGCAGTCCTGTCAAGCACATCATGAG
GAAGATGCATGGCTTCAGGCGGCCCTGGAGCATTTACGAGAGCCGAGCAGCAACTGCCACCTCTTCAACAAGTGT
GGCTTGGGTCTCGGGCACTTCAAGCGGAAACGATCAGCAGACCGGGGCCCATCCAGGATAAGACGGGTCTACAAG
GTGCTTGTTTGTTGGGACGGCAACTCCAACGAGAGCTGTCAAGATGGCAGCAGATATAGATACGACGCCGAACGC
AAAGGCAGGAATGTGGAAGTCGTCGACAGAATCGAACTACTCAGTACATCTGCTGTTCCAGTCTGCAACTCCATT
AGCAGGTTAAAAGTTGAGTTTCATTTATCAGACCGTACCTGGGCTGGGACATACGATGCTCTGCTGCTTCAATTC
GAGGGTCAAACGACACATACCCCTATCCCTCTCACCAACGCACCCCGTGCCGGAGACTCCGTGTTCAAAGACATT
GACCTGAAAACCATATTTGGGGCGAACAAGGTGCCATTGCGTGAGATTAAAAGCGTGCGTTTGCTGGATGTGCCC
AATCCAAACGAGTACTGGGCCAAAGATCAGTGGCGGCTCAAAGGGTTATCACTCCAGGGGATATGCGATCCTTCG
GGCAAAGCCATTCAGATGACAAAGTTTACCTCACTGGAGAAGCCTCTTCAACACGGGAGACTGGAGCGCAAAAGG
GCAAAGGCGGGTGAAGAAGGGGAAGAACGGCGGGCGTCGCAGATGTCGGTCTTGTAG
Gene >Ophio5|4564
ATGCTTCGACTATACTGGCCCCAACTTGCATTCCTCGTTACATTTCTCTGCTCTACCCTTGACCAATGTCTTGCG
GGATTACCACCAGGCGACCGGTCACTTTACGTTTTCCGTGGAGACTCTCGAAGCCCAAATCAGATTGAAGCAGAT
GGGGGCTTCCTCCCCTGGCCTGAAATAGACTACAATGACCCTAGAGGTTATAGTCTTTGGGATCACGTCAACGCC
CAGTCGCCGCATTCAGCCTACATATCAACCTCGAGAAGCTTCGGGCAGTCAGCCGTCAACTTCGCCAATGCACAG
GGCTTCGGAAATTACGTGTACCGCATCCATATAACTCCTAACATGATTGATGTGAACAATGTATTCCCCAATGGT
CCCTATACCTTCCAGAATGAAGTCAGTGCGTTAGGAGGCATCCCATGGAATGCGGTCCAAGGATGGTTACAGATG
CCCGGGGAAGACAGCGACTCCGGAGTATTCGATCTCGACGCTCCGCGGTTCGACAACGACTTAGCGGATAATTAC
ACGATGAGATACGAAACTGATTTCGAGTCACGATTCATTAACAACCCGGGCTATGTTACCGAAGGGCGTGAGGGG
ACTACGGTACGAACATTGGACGATGAAGATGTCGCTACTCTGAGGGGAGGAACACCAAGCGAGAGAAAAGTGATA
ATCGAAGCCGCGGAACGATTCATGAACAGAAATGGTCGAATGGTTGGGTGGACGACGAATCAGCGTTTTCCTCTG
TGGCGGCCACAAACTGGTTCCGTTCAAGCGTCGCCGCCACACACCGACGGCCATGGTAGGTACTGGCCATCACAA
CATCTCACGGAATCCTTTCCACCCTTTTCCTCCAAGCAGGTCTATAGTGGTGTAACGTGTGACCGCAACGCTGAT
GATGAAAACCAAAAGCCGCAAACACCTCTAATAGAAAGATGGACTGCCCTTCTTCTTCCTCGAGTAAGAGTCAAA
CGACGGATCAAGTTTTTGAGTTGGATGAAGCCGATCTCATGGACATCGAAGAATTTCTGGCCGATCAAGAGTCCA
AATGCGAAGAGAATTCAAATGCAGGAAACGGCCCTCTCAGAGCCGAGGCAAGTGCTGCCATGGCCAGAGCCGCGG
AGAGAGTGGAGCAGTCCTGTCAAGCACATCATGAGGAAGATGCATGGCTTCAGGCGGCCCTGGAGCATTTACGAG
AGCCGAGCAGCAACTGCCACCTCTTCAACAAGTGTGGCTTGGGTCTCGGGCACTTCAAGCGGAAACGATCAGCAG
GTAAATCACCCGCACCACGCCCATTCATCATTCTGGCATAGCTGGTTACCGATGCTGAGTAGAGTCTTTCATTGC
AGACCGGGGCCCATCCAGGATAAGACGGGTCTGTGAGAAATTAAAAAAAAGCCTAACGACCCAAAATAAAGACAA
GGTGCTTGTTTGTTGGGACGGCAACTCCAACGAGAGCTGTCAAGATGGCAGCAGATATAGATACGACGCCGAACG
CAAAGGCAGGAATGTGGAAGTCGTCGACAGAATCGAACTACTCAGTACATGTAAGGAGTTATCAAGCGCATCGAC
GTCTGCCGCTAACTGTCGTATGTTTGCAGCTGCTGTTCCAGTCTGCAACTCCATTAGCAGGTTAAAAGTTGAGTT
TCATTTATCAGACCGTACCTGGGCTGGGACATACGATGCTCTGCTGCTTCAATTCGAGGGTCAAACGACACATAC
CCCTATCCCTCTCACCAACGCACCCCGTGCCGGAGACTCCGTGTTCAAAGACATTGACCTGAAAACCATATTTGG
GGCGAACAAGGTGCCATTGCGTGAGATTAAAAGCGTGCGTTTGCTGGATGTGCCCAATCCAAACGAGTACTGGGC
CAAAGATCAGTGGCGGCTCAAAGGTAGTCACTGCTGTTTTATTTTCTTGCTTGAGAGACGGGCTCTGACCTTTAT
CCCCATTAGGGTTATCACTCCAGGGGATATGCGATCCTTCGGGCAAAGCCATTCAGATGACAAAGTTTACCTCAC
TGGAGAAGCCTCTTCAACACGGGGTAGGTTATGATGCCGACTTAATATGGTCCGGAAAAATAAGCCCCAGAGACT
GGAGCGCAAAAGGGCAAAGGCGGGTGAAGAAGGGGAAGAACGGCGGGCGTCGCAGATGTCGGTCTTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail