Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4563
Gene name
Locationscaffold_363:5051..7119
Strand-
Gene length (bp)2068
Transcript length (bp)1797
Coding sequence length (bp)1794
Protein length (aa) 598

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06863 DUF1254 Protein of unknown function (DUF1254) 1.3E-24 68 213
PF06742 DUF1214 Protein of unknown function (DUF1214) 3.1E-18 374 485

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.2567 0.1512 0.7959 0.0883 0.1892 0.0369 0.2254 0.2044 0.3082 0.023

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.999746

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup320
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|513
Ophiocordyceps australis map64 (Brazil) OphauB2|5354
Ophiocordyceps camponoti-floridani Ophcf2|00923
Ophiocordyceps camponoti-rufipedis Ophun1|512
Ophiocordyceps kimflemingae Ophio5|4563 (this protein)
Ophiocordyceps kimflemingae Ophio5|7261
Ophiocordyceps subramaniannii Hirsu2|252
Ophiocordyceps subramaniannii Hirsu2|4440
Ophiocordyceps subramaniannii Hirsu2|6269
Ophiocordyceps subramaniannii Hirsu2|6270

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4563
MMRFSSIGLALGAILCTAWALPTHDGPPGTDEETLRAINATAFAITYGYPLAHFDATVEPVLASVGTNAFQHQRN
TVRADDDDDDDDQLPTARPNTDVLYSVAAIDLSTTDVILTIPKIGNSRYFVVSFYDLWSNNLANVGRLTMSVPGK
YLLKIANRPWQIGWVEADEGNTDYAGYVYFPTIYGLVLSQMLVRNNEADVQAAREAQSGIKLTTEPRPGPRLGPK
LTSELLGDGVLEPIAQRPVGQLSQHSARDLLDVVARVDPFNRPWRPRDGASVTRQFEDAGLAHGEYEPPSELQYE
RAMQIVDKGLLEAEKRLQPYGNGWFGFPHGMTGIFGDQYAVRSLAASIDYLQLVPSEALFLTWMGDSGHQGARDG
LTLDHGDALVVTFPSGKPPVTVSGFWTLSVYDADGGLVPNDLGRYSLGDGSNLTYVTGQPVYGFSNRTDAFSILV
QPRDVRPPANWTNNWLPAPSGGDKFSINLRLIGPKLPLTAGSSVAIPWCASGGLDRLVRGLGNGASQAVALGAHH
YSSNIHAANVPCSGRFSHRTMYYCIHVSVFADSSFHEDAFCVCTCKQGQHLHYMASITPQRHAYTDTMTKRRP
Coding >Ophio5|4563
ATGATGAGATTTTCCAGTATCGGCCTGGCCCTTGGTGCCATCCTCTGCACGGCTTGGGCCCTTCCCACACACGAC
GGCCCTCCCGGCACCGACGAGGAAACGCTGCGGGCGATAAACGCAACGGCCTTTGCTATAACGTACGGCTACCCC
TTGGCTCATTTCGACGCCACCGTAGAGCCCGTGCTGGCCTCGGTTGGCACCAATGCCTTTCAGCACCAGAGAAAC
ACTGTCAGGGCGGATGATGACGACGACGATGACGACCAACTGCCTACTGCTCGACCCAACACCGACGTGCTCTAC
TCCGTGGCCGCCATAGACCTTTCTACCACCGATGTGATCCTGACGATACCAAAGATAGGCAACAGTCGTTACTTT
GTTGTTTCCTTTTACGACCTCTGGTCAAACAACCTTGCCAACGTAGGAAGGCTCACGATGAGCGTCCCCGGCAAG
TATCTGCTCAAAATCGCCAACCGACCATGGCAGATCGGATGGGTCGAGGCAGATGAAGGCAACACAGACTACGCA
GGCTACGTCTACTTTCCCACAATCTACGGCCTCGTCCTCTCACAGATGTTAGTTCGGAACAACGAAGCAGACGTT
CAAGCGGCGCGAGAGGCTCAGAGTGGCATCAAGTTGACGACGGAACCCCGTCCCGGACCTCGTCTCGGCCCAAAG
CTCACGTCCGAACTGCTAGGCGATGGCGTTCTCGAGCCAATCGCGCAGCGACCAGTCGGCCAGCTGAGCCAACAC
TCGGCGCGGGACCTCCTCGATGTCGTAGCCCGAGTCGATCCCTTCAACCGACCGTGGCGGCCAAGAGACGGCGCC
TCGGTCACGCGCCAGTTCGAAGACGCCGGCTTGGCACATGGCGAGTACGAGCCACCTTCTGAACTGCAGTACGAG
AGGGCGATGCAAATCGTCGACAAAGGCCTGCTGGAAGCTGAGAAGAGGCTGCAGCCGTACGGCAATGGCTGGTTC
GGTTTCCCTCACGGCATGACCGGCATCTTCGGCGACCAGTATGCCGTCCGTAGCCTCGCCGCCTCGATTGACTAT
CTGCAGCTGGTCCCCTCCGAGGCCCTGTTCCTGACCTGGATGGGTGACAGCGGCCACCAGGGAGCAAGGGACGGC
CTGACGCTCGATCACGGGGACGCCCTCGTGGTAACCTTTCCGTCTGGAAAGCCCCCCGTCACCGTCAGCGGCTTC
TGGACCCTGTCGGTGTACGACGCCGACGGCGGTCTTGTTCCCAATGACCTGGGTCGCTATTCGCTCGGCGACGGT
AGTAACCTGACGTACGTCACCGGTCAACCCGTCTATGGCTTCTCGAACCGCACCGATGCCTTTTCCATTCTGGTT
CAGCCACGGGACGTGCGTCCTCCGGCCAACTGGACGAATAACTGGCTCCCGGCGCCGTCTGGGGGCGACAAGTTT
TCCATCAATCTGCGTCTTATCGGCCCGAAACTGCCGCTAACCGCTGGCTCATCGGTTGCCATTCCCTGGTGTGCC
TCCGGGGGGTTGGACAGGTTGGTGAGGGGGTTGGGGAATGGAGCAAGCCAAGCCGTTGCCCTAGGAGCCCATCAC
TATTCATCCAATATACATGCTGCCAACGTGCCATGCTCTGGTCGGTTCTCACATCGTACAATGTACTACTGCATT
CACGTTTCCGTTTTCGCGGACTCGTCGTTTCATGAGGATGCATTCTGTGTATGTACATGCAAACAAGGCCAACAC
CTTCATTATATGGCCTCTATTACACCTCAACGCCACGCATACACCGATACCATGACAAAAAGACGACCA
Transcript >Ophio5|4563
ATGATGAGATTTTCCAGTATCGGCCTGGCCCTTGGTGCCATCCTCTGCACGGCTTGGGCCCTTCCCACACACGAC
GGCCCTCCCGGCACCGACGAGGAAACGCTGCGGGCGATAAACGCAACGGCCTTTGCTATAACGTACGGCTACCCC
TTGGCTCATTTCGACGCCACCGTAGAGCCCGTGCTGGCCTCGGTTGGCACCAATGCCTTTCAGCACCAGAGAAAC
ACTGTCAGGGCGGATGATGACGACGACGATGACGACCAACTGCCTACTGCTCGACCCAACACCGACGTGCTCTAC
TCCGTGGCCGCCATAGACCTTTCTACCACCGATGTGATCCTGACGATACCAAAGATAGGCAACAGTCGTTACTTT
GTTGTTTCCTTTTACGACCTCTGGTCAAACAACCTTGCCAACGTAGGAAGGCTCACGATGAGCGTCCCCGGCAAG
TATCTGCTCAAAATCGCCAACCGACCATGGCAGATCGGATGGGTCGAGGCAGATGAAGGCAACACAGACTACGCA
GGCTACGTCTACTTTCCCACAATCTACGGCCTCGTCCTCTCACAGATGTTAGTTCGGAACAACGAAGCAGACGTT
CAAGCGGCGCGAGAGGCTCAGAGTGGCATCAAGTTGACGACGGAACCCCGTCCCGGACCTCGTCTCGGCCCAAAG
CTCACGTCCGAACTGCTAGGCGATGGCGTTCTCGAGCCAATCGCGCAGCGACCAGTCGGCCAGCTGAGCCAACAC
TCGGCGCGGGACCTCCTCGATGTCGTAGCCCGAGTCGATCCCTTCAACCGACCGTGGCGGCCAAGAGACGGCGCC
TCGGTCACGCGCCAGTTCGAAGACGCCGGCTTGGCACATGGCGAGTACGAGCCACCTTCTGAACTGCAGTACGAG
AGGGCGATGCAAATCGTCGACAAAGGCCTGCTGGAAGCTGAGAAGAGGCTGCAGCCGTACGGCAATGGCTGGTTC
GGTTTCCCTCACGGCATGACCGGCATCTTCGGCGACCAGTATGCCGTCCGTAGCCTCGCCGCCTCGATTGACTAT
CTGCAGCTGGTCCCCTCCGAGGCCCTGTTCCTGACCTGGATGGGTGACAGCGGCCACCAGGGAGCAAGGGACGGC
CTGACGCTCGATCACGGGGACGCCCTCGTGGTAACCTTTCCGTCTGGAAAGCCCCCCGTCACCGTCAGCGGCTTC
TGGACCCTGTCGGTGTACGACGCCGACGGCGGTCTTGTTCCCAATGACCTGGGTCGCTATTCGCTCGGCGACGGT
AGTAACCTGACGTACGTCACCGGTCAACCCGTCTATGGCTTCTCGAACCGCACCGATGCCTTTTCCATTCTGGTT
CAGCCACGGGACGTGCGTCCTCCGGCCAACTGGACGAATAACTGGCTCCCGGCGCCGTCTGGGGGCGACAAGTTT
TCCATCAATCTGCGTCTTATCGGCCCGAAACTGCCGCTAACCGCTGGCTCATCGGTTGCCATTCCCTGGTGTGCC
TCCGGGGGGTTGGACAGGTTGGTGAGGGGGTTGGGGAATGGAGCAAGCCAAGCCGTTGCCCTAGGAGCCCATCAC
TATTCATCCAATATACATGCTGCCAACGTGCCATGCTCTGGTCGGTTCTCACATCGTACAATGTACTACTGCATT
CACGTTTCCGTTTTCGCGGACTCGTCGTTTCATGAGGATGCATTCTGTGTATGTACATGCAAACAAGGCCAACAC
CTTCATTATATGGCCTCTATTACACCTCAACGCCACGCATACACCGATACCATGACAAAAAGACGACCATAA
Gene >Ophio5|4563
ATGATGAGATTTTCCAGTATCGGCCTGGCCCTTGGTGCCATCCTCTGCACGGCTTGGGCCCTTCCCACACACGAC
GGCCCTCCCGGCACCGACGAGGAAACGCTGCGGGCGATAAACGCAACGGCCTTTGCTATAACGGTGAGTGCCTGA
GGGCCGCGTTCTTTGTTGATCTTGACTGACTCGGTCAGTACGGCTACCCCTTGGCTCATTTCGACGCCACCGTAG
AGCCCGTGCTGGCCTCGGTTGGCACCAATGCCTTTCAGCACCAGAGAAACACTGTCAGGGCGGATGATGACGACG
ACGATGACGACCAACTGCCTACTGCTCGACCCAACACCGACGTGCTCTACTCCGTGGCCGCCATAGACCTTTCTA
CCACCGATGTGATCCTGACGATACCAAAGATAGGCAACAGTCGTTACTTTGTTGTTTCCTTTTACGACCTGTAAG
TCATGACCGAGTGTTGAATCCCTTATTATTACCCTTATACACGTTTGATAACTAACGGCTGCCGCCCTGCTCGCT
CAGCTGGTCAAACAACCTTGCCAACGTAGGAAGGCTCACGATGAGCGTCCCCGGCAAGTATCTGCTCAAAATCGC
CAACCGACCATGGCAGATCGGATGGGTCGAGGCAGATGAAGGCAACACAGACTACGCAGGCTACGTCTACTTTCC
CACAATCTACGGCCTCGTCCTCTCACAGATGTTAGTTCGGAACAACGAAGCAGACGTTCAAGCGGCGCGAGAGGC
TCAGAGTGGCATCAAGTTGACGACGGAACCCCGTCCCGGACCTCGTCTCGGCCCAAAGCTCACGTCCGAACTGCT
AGGCGATGGCGTTCTCGAGCCAATCGCGCAGCGACCAGTCGGCCAGCTGAGCCAACACTCGGCGCGGGACCTCCT
CGATGTCGTAGCCCGAGTCGATCCCTTCAACCGACCGTGGCGGCCAAGAGACGGCGCCTCGGTCACGCGCCAGTT
CGAAGACGCCGGCTTGGCACATGGCGAGTACGAGCCACCTTCTGAACTGCAGTACGAGAGGGCGATGCAAATCGT
CGACAAAGGCCTGCTGGAAGCTGAGAAGAGGCTGCAGCCGTACGGCAATGGCTGGTTCGGTTTCCCTCACGGCAT
GACCGGCATCTTCGGCGACCAGTATGCCGTCCGTAGCCTCGCCGCCTCGATTGACTATCTGCAGCTGGTCCCCTC
CGAGGCCCTGTTCCTGACCTGGATGGGTGACAGCGGCCACCAGGGAGCAAGGGACGGCCTGACGCTCGATCACGG
GGACGCCCTCGTGGTAACCTTTCCGTCTGGAAAGCCCCCCGTCACCGTCAGCGGCTTCTGGACCCTGTCGGTGTA
CGACGCCGACGGCGGTCTTGTTCCCAATGACCTGGGTCGCTATTCGCTCGGCGACGGTAGTAACCTGACGTACGT
CACCGGTCAACCCGTCTATGGCTTCTCGAACCGCACCGATGCCTTTTCCATTCTGGTTCAGCCACGGGACGTGCG
TCCTCCGGCCAACTGGACGAATAACTGGCTCCCGGCGCCGTCTGGGGGCGACAAGTTTTCCATCAATCGTGAGTT
GTCGTTTTGTGTCTCTTTTCAACACCTCGGGGACGGATGTTCTTCACCGTCTTTGCTTGGCTAACTTGCCCTGCA
GTGCGTCTTATCGGCCCGAAACTGCCGCTAACCGCTGGCTCATCGTATGTTTACCCAATCGTCACCAGGCGAAGA
GCGATTGTTGGTTAAGTTGCTCAGGGTTGCCATTCCCTGGTGTGCCTCCGGGGGGTTGGACAGGTTGGTGAGGGG
GTTGGGGAATGGAGCAAGCCAAGCCGTTGCCCTAGGAGCCCATCACTATTCATCCAATATACATGCTGCCAACGT
GCCATGCTCTGGTCGGTTCTCACATCGTACAATGTACTACTGCATTCACGTTTCCGTTTTCGCGGACTCGTCGTT
TCATGAGGATGCATTCTGTGTATGTACATGCAAACAAGGCCAACACCTTCATTATATGGCCTCTATTACACCTCA
ACGCCACGCATACACCGATACCATGACAAAAAGACGACCATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail