Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4559
Gene name
Locationscaffold_362:11441..16536
Strand-
Gene length (bp)5095
Transcript length (bp)4374
Coding sequence length (bp)4371
Protein length (aa) 1457

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00005 ABC_tran ABC transporter 6.0E-17 639 772
PF00005 ABC_tran ABC transporter 3.1E-32 1236 1381
PF00664 ABC_membrane ABC transporter transmembrane region 1.7E-28 904 1149

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q28689|MRP2_RABIT Canalicular multispecific organic anion transporter 1 OS=Oryctolagus cuniculus GN=ABCC2 PE=2 SV=1 28 1440 6.0E-162
sp|P39109|YCFI_YEAST Metal resistance protein YCF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCF1 PE=1 SV=2 63 1448 1.0E-160
sp|Q8VI47|MRP2_MOUSE Canalicular multispecific organic anion transporter 1 OS=Mus musculus GN=Abcc2 PE=1 SV=2 28 1438 1.0E-159
sp|Q63120|MRP2_RAT Canalicular multispecific organic anion transporter 1 OS=Rattus norvegicus GN=Abcc2 PE=1 SV=1 28 1445 1.0E-158
sp|Q5F364|MRP1_CHICK Multidrug resistance-associated protein 1 OS=Gallus gallus GN=ABCC1 PE=2 SV=1 28 1439 6.0E-155
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q28689|MRP2_RABIT Canalicular multispecific organic anion transporter 1 OS=Oryctolagus cuniculus GN=ABCC2 PE=2 SV=1 28 1440 6.0E-162
sp|P39109|YCFI_YEAST Metal resistance protein YCF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCF1 PE=1 SV=2 63 1448 1.0E-160
sp|Q8VI47|MRP2_MOUSE Canalicular multispecific organic anion transporter 1 OS=Mus musculus GN=Abcc2 PE=1 SV=2 28 1438 1.0E-159
sp|Q63120|MRP2_RAT Canalicular multispecific organic anion transporter 1 OS=Rattus norvegicus GN=Abcc2 PE=1 SV=1 28 1445 1.0E-158
sp|Q5F364|MRP1_CHICK Multidrug resistance-associated protein 1 OS=Gallus gallus GN=ABCC1 PE=2 SV=1 28 1439 6.0E-155
sp|Q92887|MRP2_HUMAN Canalicular multispecific organic anion transporter 1 OS=Homo sapiens GN=ABCC2 PE=1 SV=3 28 1439 6.0E-150
sp|Q8CG09|MRP1_RAT Multidrug resistance-associated protein 1 OS=Rattus norvegicus GN=Abcc1 PE=1 SV=2 28 1439 1.0E-147
sp|Q9P5N0|ABC3_SCHPO ATP-binding cassette transporter abc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc3 PE=2 SV=1 192 1448 1.0E-146
sp|O35379|MRP1_MOUSE Multidrug resistance-associated protein 1 OS=Mus musculus GN=Abcc1 PE=1 SV=1 28 1439 2.0E-146
sp|Q10185|ABC2_SCHPO ATP-binding cassette transporter abc2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc2 PE=1 SV=1 203 1448 4.0E-146
sp|Q9SKX0|AB13C_ARATH ABC transporter C family member 13 OS=Arabidopsis thaliana GN=ABCC13 PE=2 SV=3 197 1445 7.0E-145
sp|P32386|YBT1_YEAST ATP-dependent bile acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBT1 PE=1 SV=2 360 1450 7.0E-144
sp|Q864R9|MRP1_MACFA Multidrug resistance-associated protein 1 OS=Macaca fascicularis GN=ABCC1 PE=2 SV=1 196 1439 8.0E-143
sp|Q8HXQ5|MRP1_BOVIN Multidrug resistance-associated protein 1 OS=Bos taurus GN=ABCC1 PE=2 SV=1 28 1439 3.0E-141
sp|O88563|MRP3_RAT Canalicular multispecific organic anion transporter 2 OS=Rattus norvegicus GN=Abcc3 PE=1 SV=1 28 1438 3.0E-141
sp|Q6UR05|MRP1_CANLF Multidrug resistance-associated protein 1 OS=Canis lupus familiaris GN=ABCC1 PE=2 SV=1 28 1439 4.0E-141
sp|Q9M1C7|AB9C_ARATH ABC transporter C family member 9 OS=Arabidopsis thaliana GN=ABCC9 PE=2 SV=2 188 1455 6.0E-141
sp|B2RX12|MRP3_MOUSE Canalicular multispecific organic anion transporter 2 OS=Mus musculus GN=Abcc3 PE=1 SV=1 28 1438 2.0E-140
sp|P33527|MRP1_HUMAN Multidrug resistance-associated protein 1 OS=Homo sapiens GN=ABCC1 PE=1 SV=3 169 1439 5.0E-139
sp|Q54U44|ABCCC_DICDI ABC transporter C family member 12 OS=Dictyostelium discoideum GN=abcC12 PE=3 SV=1 195 1442 4.0E-138
sp|Q7FB56|AB15C_ARATH Putative ABC transporter C family member 15 OS=Arabidopsis thaliana GN=ABCC15 PE=5 SV=2 372 1455 1.0E-137
sp|Q54JR2|ABCC3_DICDI ABC transporter C family member 3 OS=Dictyostelium discoideum GN=abcC3 PE=3 SV=1 195 1440 3.0E-135
sp|P14772|BPT1_YEAST Bile pigment transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BPT1 PE=1 SV=2 344 1451 1.0E-134
sp|Q8ST87|ABCCA_DICDI ABC transporter C family member 10 OS=Dictyostelium discoideum GN=abcC10 PE=3 SV=1 195 1442 5.0E-134
sp|Q7GB25|AB5C_ARATH ABC transporter C family member 5 OS=Arabidopsis thaliana GN=ABCC5 PE=2 SV=2 194 1448 5.0E-133
sp|Q10RX7|AB13C_ORYSJ ABC transporter C family member 13 OS=Oryza sativa subsp. japonica GN=ABCC13 PE=2 SV=1 194 1448 2.0E-131
sp|A2XCD4|AB13C_ORYSI ABC transporter C family member 13 OS=Oryza sativa subsp. indica GN=ABCC13 PE=3 SV=1 194 1448 2.0E-131
sp|O15439|MRP4_HUMAN Multidrug resistance-associated protein 4 OS=Homo sapiens GN=ABCC4 PE=1 SV=3 195 1452 1.0E-130
sp|Q7DM58|AB4C_ARATH ABC transporter C family member 4 OS=Arabidopsis thaliana GN=ABCC4 PE=2 SV=2 189 1438 2.0E-129
sp|P70170|ABCC9_MOUSE ATP-binding cassette sub-family C member 9 OS=Mus musculus GN=Abcc9 PE=1 SV=2 343 1448 4.0E-129
sp|Q63563|ABCC9_RAT ATP-binding cassette sub-family C member 9 OS=Rattus norvegicus GN=Abcc9 PE=1 SV=1 343 1448 7.0E-129
sp|A7KVC2|AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays GN=MRP4 PE=2 SV=1 179 1448 8.0E-129
sp|P82451|ABCC9_RABIT ATP-binding cassette sub-family C member 9 OS=Oryctolagus cuniculus GN=ABCC9 PE=2 SV=1 343 1448 1.0E-128
sp|Q42093|AB2C_ARATH ABC transporter C family member 2 OS=Arabidopsis thaliana GN=ABCC2 PE=1 SV=2 192 1450 2.0E-128
sp|Q9C8G9|AB1C_ARATH ABC transporter C family member 1 OS=Arabidopsis thaliana GN=ABCC1 PE=1 SV=1 192 1450 3.0E-128
sp|Q9LK64|AB3C_ARATH ABC transporter C family member 3 OS=Arabidopsis thaliana GN=ABCC3 PE=1 SV=1 195 1448 4.0E-128
sp|O15440|MRP5_HUMAN Multidrug resistance-associated protein 5 OS=Homo sapiens GN=ABCC5 PE=1 SV=2 187 1456 4.0E-128
sp|Q9LZJ5|AB14C_ARATH ABC transporter C family member 14 OS=Arabidopsis thaliana GN=ABCC14 PE=1 SV=1 189 1438 7.0E-128
sp|O60706|ABCC9_HUMAN ATP-binding cassette sub-family C member 9 OS=Homo sapiens GN=ABCC9 PE=1 SV=2 343 1448 1.0E-127
sp|Q96J66|ABCCB_HUMAN ATP-binding cassette sub-family C member 11 OS=Homo sapiens GN=ABCC11 PE=1 SV=1 196 1448 3.0E-127
sp|Q9C8H0|AB12C_ARATH ABC transporter C family member 12 OS=Arabidopsis thaliana GN=ABCC12 PE=2 SV=1 192 1445 4.0E-127
sp|Q9R1X5|MRP5_MOUSE Multidrug resistance-associated protein 5 OS=Mus musculus GN=Abcc5 PE=1 SV=2 187 1456 4.0E-127
sp|Q09429|ABCC8_RAT ATP-binding cassette sub-family C member 8 OS=Rattus norvegicus GN=Abcc8 PE=1 SV=4 343 1445 6.0E-127
sp|Q9QYM0|MRP5_RAT Multidrug resistance-associated protein 5 OS=Rattus norvegicus GN=Abcc5 PE=2 SV=1 187 1456 9.0E-127
sp|Q9C8H1|AB11C_ARATH ABC transporter C family member 11 OS=Arabidopsis thaliana GN=ABCC11 PE=2 SV=2 193 1448 6.0E-126
sp|Q09428|ABCC8_HUMAN ATP-binding cassette sub-family C member 8 OS=Homo sapiens GN=ABCC8 PE=1 SV=6 343 1445 2.0E-125
sp|Q09427|ABCC8_CRICR ATP-binding cassette sub-family C member 8 OS=Cricetus cricetus GN=ABCC8 PE=1 SV=3 343 1445 3.0E-125
sp|Q80WJ6|MRP9_MOUSE Multidrug resistance-associated protein 9 OS=Mus musculus GN=Abcc12 PE=2 SV=1 195 1445 5.0E-125
sp|Q8T6H3|ABCC6_DICDI ABC transporter C family member 6 OS=Dictyostelium discoideum GN=abcC6 PE=3 SV=1 190 1448 9.0E-125
sp|O95255|MRP6_HUMAN Multidrug resistance-associated protein 6 OS=Homo sapiens GN=ABCC6 PE=1 SV=2 64 1446 9.0E-125
sp|Q96J65|MRP9_HUMAN Multidrug resistance-associated protein 9 OS=Homo sapiens GN=ABCC12 PE=1 SV=2 195 1445 1.0E-124
sp|Q6Y306|MRP9_RAT Multidrug resistance-associated protein 9 OS=Rattus norvegicus GN=Abcc12 PE=2 SV=1 195 1445 5.0E-124
sp|Q54LE6|ABCC5_DICDI ABC transporter C family member 5 OS=Dictyostelium discoideum GN=abcC5 PE=3 SV=1 195 1451 8.0E-124
sp|Q8LGU1|AB8C_ARATH ABC transporter C family member 8 OS=Arabidopsis thaliana GN=ABCC8 PE=2 SV=3 199 1448 9.0E-124
sp|P91660|L259_DROME Probable multidrug resistance-associated protein lethal(2)03659 OS=Drosophila melanogaster GN=l(2)03659 PE=2 SV=3 214 1443 2.0E-122
sp|P38735|VMR1_YEAST ABC transporter ATP-binding protein/permease VMR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMR1 PE=2 SV=1 291 1445 6.0E-122
sp|Q8VZZ4|AB6C_ARATH ABC transporter C family member 6 OS=Arabidopsis thaliana GN=ABCC6 PE=2 SV=3 189 1448 1.0E-121
sp|P53049|YOR1_YEAST Oligomycin resistance ATP-dependent permease YOR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR1 PE=1 SV=1 257 1448 1.0E-121
sp|Q9LK62|AB7C_ARATH ABC transporter C family member 7 OS=Arabidopsis thaliana GN=ABCC7 PE=1 SV=1 344 1448 5.0E-121
sp|Q9LYS2|AB10C_ARATH ABC transporter C family member 10 OS=Arabidopsis thaliana GN=ABCC10 PE=2 SV=2 194 1451 3.0E-119
sp|Q92337|ABC1_SCHPO ATP-binding cassette transporter abc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc1 PE=3 SV=1 195 1437 1.0E-117
sp|P0CE70|NFT1_YEASX ABC transporter NFT1 OS=Saccharomyces cerevisiae GN=NFT1 PE=3 SV=1 361 1448 2.0E-114
sp|C8ZCR2|NFT1_YEAS8 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=NFT1 PE=3 SV=1 361 1448 2.0E-114
sp|A7A063|NFT1_YEAS7 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain YJM789) GN=NFT1 PE=3 SV=1 361 1448 6.0E-114
sp|Q54V86|ABCCD_DICDI ABC transporter C family member 13 OS=Dictyostelium discoideum GN=abcC13 PE=3 SV=1 196 1448 3.0E-113
sp|Q5T3U5|MRP7_HUMAN Multidrug resistance-associated protein 7 OS=Homo sapiens GN=ABCC10 PE=1 SV=1 179 1437 7.0E-111
sp|Q9R1S7|MRP6_MOUSE Multidrug resistance-associated protein 6 OS=Mus musculus GN=Abcc6 PE=1 SV=3 64 1450 3.0E-110
sp|O88269|MRP6_RAT Multidrug resistance-associated protein 6 OS=Rattus norvegicus GN=Abcc6 PE=1 SV=1 64 1446 4.0E-110
sp|Q54NL1|ABCC9_DICDI ABC transporter C family member 9 OS=Dictyostelium discoideum GN=abcC9 PE=3 SV=1 196 1448 1.0E-109
sp|Q54VJ0|ABCC2_DICDI ABC transporter C family member 2 OS=Dictyostelium discoideum GN=abcC2 PE=3 SV=1 605 1448 4.0E-109
sp|Q54EK2|ABCC7_DICDI ABC transporter C family member 7 OS=Dictyostelium discoideum GN=abcC7 PE=3 SV=1 183 1430 2.0E-108
sp|P21441|MDR_LEITA Multidrug resistance protein OS=Leishmania tarentolae GN=PGPA PE=3 SV=2 263 1452 2.0E-107
sp|Q8T6H8|ABCC1_DICDI ABC transporter C family member 1 OS=Dictyostelium discoideum GN=abcC1 PE=3 SV=1 174 1454 3.0E-107
sp|Q9P7V2|ABC4_SCHPO ATP-binding cassette transporter abc4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc4 PE=3 SV=1 326 1448 8.0E-106
sp|Q54K24|ABCCE_DICDI ABC transporter C family member 14 OS=Dictyostelium discoideum GN=abcC14 PE=3 SV=1 639 1448 9.0E-96
sp|O15438|MRP3_HUMAN Canalicular multispecific organic anion transporter 2 OS=Homo sapiens GN=ABCC3 PE=1 SV=3 876 1438 6.0E-87
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum GN=abcC8 PE=3 SV=1 880 1448 2.0E-81
sp|Q5A762|MLT1_CANAL Multiple drug resistance-associated protein-like transporter 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MLT1 PE=1 SV=1 876 1448 9.0E-80
sp|Q54VC1|ABCCF_DICDI ABC transporter C family member 15 OS=Dictyostelium discoideum GN=abcC15 PE=3 SV=1 879 1448 3.0E-76
sp|Q8R4P9|MRP7_MOUSE Multidrug resistance-associated protein 7 OS=Mus musculus GN=Abcc10 PE=1 SV=1 938 1437 3.0E-73
sp|Q07E42|CFTR_DASNO Cystic fibrosis transmembrane conductance regulator OS=Dasypus novemcinctus GN=CFTR PE=3 SV=1 940 1447 5.0E-71
sp|Q00PJ2|CFTR_ATEAB Cystic fibrosis transmembrane conductance regulator OS=Atelerix albiventris GN=CFTR PE=3 SV=1 968 1447 8.0E-71
sp|Q2IBF6|CFTR_GORGO Cystic fibrosis transmembrane conductance regulator OS=Gorilla gorilla gorilla GN=CFTR PE=3 SV=1 968 1447 2.0E-70
sp|Q5U820|CFTR_CANLF Cystic fibrosis transmembrane conductance regulator OS=Canis lupus familiaris GN=CFTR PE=2 SV=2 939 1447 4.0E-70
sp|Q2IBA1|CFTR_CHLAE Cystic fibrosis transmembrane conductance regulator OS=Chlorocebus aethiops GN=CFTR PE=3 SV=1 968 1447 6.0E-70
sp|Q00553|CFTR_MACMU Cystic fibrosis transmembrane conductance regulator OS=Macaca mulatta GN=CFTR PE=2 SV=2 968 1447 6.0E-70
sp|Q7JII7|CFTR_MACFU Cystic fibrosis transmembrane conductance regulator OS=Macaca fuscata fuscata GN=CFTR PE=3 SV=1 968 1447 6.0E-70
sp|Q7JII8|CFTR_MACFA Cystic fibrosis transmembrane conductance regulator OS=Macaca fascicularis GN=CFTR PE=3 SV=1 968 1447 6.0E-70
sp|Q9TSP5|CFTR_PAPAN Cystic fibrosis transmembrane conductance regulator OS=Papio anubis GN=CFTR PE=3 SV=1 968 1447 7.0E-70
sp|Q9TUQ2|CFTR_MACNE Cystic fibrosis transmembrane conductance regulator OS=Macaca nemestrina GN=CFTR PE=3 SV=1 968 1438 1.0E-69
sp|P13569|CFTR_HUMAN Cystic fibrosis transmembrane conductance regulator OS=Homo sapiens GN=CFTR PE=1 SV=3 968 1447 1.0E-69
sp|Q2QL74|CFTR_DIDVI Cystic fibrosis transmembrane conductance regulator OS=Didelphis virginiana GN=CFTR PE=3 SV=1 958 1447 1.0E-69
sp|Q2QLA3|CFTR_HORSE Cystic fibrosis transmembrane conductance regulator OS=Equus caballus GN=CFTR PE=3 SV=1 968 1438 3.0E-69
sp|Q2IBE4|CFTR_PONAB Cystic fibrosis transmembrane conductance regulator OS=Pongo abelii GN=CFTR PE=3 SV=1 968 1438 3.0E-69
sp|Q07DV2|CFTR_AOTNA Cystic fibrosis transmembrane conductance regulator OS=Aotus nancymaae GN=CFTR PE=3 SV=1 968 1447 3.0E-69
sp|Q07DY5|CFTR_COLGU Cystic fibrosis transmembrane conductance regulator OS=Colobus guereza GN=CFTR PE=3 SV=1 968 1447 4.0E-69
sp|Q09YH0|CFTR_SAIBB Cystic fibrosis transmembrane conductance regulator OS=Saimiri boliviensis boliviensis GN=CFTR PE=3 SV=1 968 1447 5.0E-69
sp|Q2QLH0|CFTR_OTOGA Cystic fibrosis transmembrane conductance regulator OS=Otolemur garnettii GN=CFTR PE=3 SV=1 968 1447 5.0E-69
sp|Q2QLF9|CFTR_CALJA Cystic fibrosis transmembrane conductance regulator OS=Callithrix jacchus GN=CFTR PE=3 SV=1 968 1447 7.0E-69
sp|Q07DZ6|CFTR_ORNAN Cystic fibrosis transmembrane conductance regulator OS=Ornithorhynchus anatinus GN=CFTR PE=3 SV=1 968 1447 1.0E-68
sp|Q5D1Z7|CFTR_TRIVU Cystic fibrosis transmembrane conductance regulator OS=Trichosurus vulpecula GN=CFTR PE=2 SV=1 958 1438 3.0E-68
sp|Q2QLE5|CFTR_PANTR Cystic fibrosis transmembrane conductance regulator OS=Pan troglodytes GN=CFTR PE=3 SV=1 968 1447 3.0E-68
sp|Q2QL83|CFTR_MICMU Cystic fibrosis transmembrane conductance regulator OS=Microcebus murinus GN=CFTR PE=3 SV=1 968 1447 4.0E-68
sp|Q00554|CFTR_RABIT Cystic fibrosis transmembrane conductance regulator OS=Oryctolagus cuniculus GN=CFTR PE=2 SV=4 940 1447 8.0E-68
sp|Q00552|CFTR_CAVPO Cystic fibrosis transmembrane conductance regulator OS=Cavia porcellus GN=CFTR PE=2 SV=2 968 1447 1.0E-67
sp|Q2QLB4|CFTR_CALMO Cystic fibrosis transmembrane conductance regulator OS=Callicebus moloch GN=CFTR PE=3 SV=1 968 1438 1.0E-66
sp|P26361|CFTR_MOUSE Cystic fibrosis transmembrane conductance regulator OS=Mus musculus GN=Cftr PE=1 SV=2 900 1453 1.0E-66
sp|Q07E16|CFTR_MUSPF Cystic fibrosis transmembrane conductance regulator OS=Mustela putorius furo GN=CFTR PE=3 SV=1 968 1447 1.0E-66
sp|Q07DX5|CFTR_NOMLE Cystic fibrosis transmembrane conductance regulator OS=Nomascus leucogenys GN=CFTR PE=3 SV=1 968 1447 6.0E-66
sp|Q108U0|CFTR_LOXAF Cystic fibrosis transmembrane conductance regulator OS=Loxodonta africana GN=CFTR PE=3 SV=1 945 1447 6.0E-66
sp|Q09YK5|CFTR_ATEGE Cystic fibrosis transmembrane conductance regulator OS=Ateles geoffroyi GN=CFTR PE=3 SV=1 968 1438 7.0E-66
sp|P26363|CFTR_XENLA Cystic fibrosis transmembrane conductance regulator OS=Xenopus laevis GN=cftr PE=2 SV=1 847 1438 2.0E-65
sp|Q2IBB3|CFTR_RHIFE Cystic fibrosis transmembrane conductance regulator OS=Rhinolophus ferrumequinum GN=CFTR PE=3 SV=1 968 1438 2.0E-65
sp|P34158|CFTR_RAT Cystic fibrosis transmembrane conductance regulator OS=Rattus norvegicus GN=Cftr PE=1 SV=3 940 1438 4.0E-65
sp|Q6PQZ2|CFTR_PIG Cystic fibrosis transmembrane conductance regulator OS=Sus scrofa GN=CFTR PE=2 SV=1 968 1447 7.0E-65
sp|Q00555|CFTR_SHEEP Cystic fibrosis transmembrane conductance regulator OS=Ovis aries GN=CFTR PE=1 SV=2 900 1447 3.0E-64
sp|P35071|CFTR_BOVIN Cystic fibrosis transmembrane conductance regulator OS=Bos taurus GN=CFTR PE=2 SV=2 900 1447 9.0E-64
sp|Q07DW5|CFTR_MUNRE Cystic fibrosis transmembrane conductance regulator OS=Muntiacus reevesi GN=CFTR PE=3 SV=1 900 1447 1.0E-62
sp|Q09YJ4|CFTR_MUNMU Cystic fibrosis transmembrane conductance regulator OS=Muntiacus muntjak GN=CFTR PE=3 SV=1 900 1447 1.0E-62
sp|Q2QLC5|CFTR_CARPS Cystic fibrosis transmembrane conductance regulator OS=Carollia perspicillata GN=CFTR PE=3 SV=1 968 1438 3.0E-61
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum GN=abcC8 PE=3 SV=1 28 850 1.0E-60
sp|P26362|CFTR_SQUAC Cystic fibrosis transmembrane conductance regulator OS=Squalus acanthias GN=CFTR PE=1 SV=1 968 1452 2.0E-59
sp|P0CE69|YK104_YEAST Putative uncharacterized protein YKR104W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKR104W PE=5 SV=1 1184 1448 2.0E-54
sp|P35598|EXP8_STRPN Putative ABC transporter ATP-binding protein exp8 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=exp8 PE=3 SV=3 893 1438 1.0E-49
sp|P0CE68|NFT1_YEAST ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NFT1 PE=3 SV=1 361 1137 3.0E-49
sp|Q9VL32|SUR_DROME ATP-binding cassette sub-family C member Sur OS=Drosophila melanogaster GN=Sur PE=1 SV=4 1208 1451 8.0E-49
sp|Q5A762|MLT1_CANAL Multiple drug resistance-associated protein-like transporter 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MLT1 PE=1 SV=1 198 837 2.0E-48
sp|P34712|PGP1_CAEEL Multidrug resistance protein pgp-1 OS=Caenorhabditis elegans GN=pgp-1 PE=1 SV=2 637 1451 4.0E-48
sp|O07549|YHEH_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheH OS=Bacillus subtilis (strain 168) GN=yheH PE=1 SV=1 973 1450 9.0E-48
sp|O15438|MRP3_HUMAN Canalicular multispecific organic anion transporter 2 OS=Homo sapiens GN=ABCC3 PE=1 SV=3 28 837 1.0E-47
sp|Q9WYC4|Y288_THEMA Uncharacterized ABC transporter ATP-binding protein TM_0288 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0288 PE=1 SV=1 876 1439 2.0E-47
sp|Q9JI39|ABCBA_MOUSE ATP-binding cassette sub-family B member 10, mitochondrial OS=Mus musculus GN=Abcb10 PE=1 SV=1 956 1451 3.0E-45
sp|Q9NRK6|ABCBA_HUMAN ATP-binding cassette sub-family B member 10, mitochondrial OS=Homo sapiens GN=ABCB10 PE=1 SV=2 974 1451 2.0E-44
sp|Q57180|Y1051_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_1051 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1051 PE=3 SV=1 875 1455 2.0E-42
sp|P63398|Y1303_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb1303c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1303c PE=3 SV=1 985 1438 7.0E-42
sp|P9WQJ3|Y1272_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1272c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1272c PE=1 SV=1 985 1438 7.0E-42
sp|P9WQJ2|Y1272_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1310 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1310 PE=3 SV=1 985 1438 7.0E-42
sp|Q1GZI0|MSBA_METFK Lipid A export ATP-binding/permease protein MsbA OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=msbA PE=3 SV=1 958 1451 1.0E-41
sp|Q8P8W4|MSBA_XANCP Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=msbA PE=3 SV=1 970 1438 3.0E-40
sp|Q4UV65|MSBA_XANC8 Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. campestris (strain 8004) GN=msbA PE=3 SV=1 970 1438 3.0E-40
sp|Q9PEE7|MSBA_XYLFA Lipid A export ATP-binding/permease protein MsbA OS=Xylella fastidiosa (strain 9a5c) GN=msbA PE=3 SV=1 893 1449 4.0E-40
sp|Q87EF0|MSBA_XYLFT Lipid A export ATP-binding/permease protein MsbA OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=msbA PE=3 SV=1 893 1449 8.0E-40
sp|Q142P6|MSBA_BURXL Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia xenovorans (strain LB400) GN=msbA PE=3 SV=1 1084 1449 8.0E-40
sp|Q0VQP5|MSBA_ALCBS Lipid A export ATP-binding/permease protein MsbA OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=msbA PE=3 SV=1 1199 1449 1.0E-39
sp|Q8PKS5|MSBA_XANAC Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=msbA PE=3 SV=1 935 1438 3.0E-39
sp|Q9RCG7|PAXB_PASAE Exotoxin translocation ATP-binding protein PaxB OS=Pasteurella aerogenes GN=paxB PE=3 SV=1 1201 1450 4.0E-39
sp|Q3BTC8|MSBA_XANC5 Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=msbA PE=3 SV=1 935 1438 4.0E-39
sp|Q5H0H0|MSBA_XANOR Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=msbA PE=3 SV=1 935 1438 4.0E-39
sp|Q2P3E7|MSBA_XANOM Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=msbA PE=3 SV=1 935 1438 4.0E-39
sp|Q47258|HLYB3_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 1201 1450 6.0E-39
sp|Q71ED1|NDVA_AGRVI Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Agrobacterium vitis GN=ndvA PE=3 SV=1 1078 1437 7.0E-39
sp|Q108U0|CFTR_LOXAF Cystic fibrosis transmembrane conductance regulator OS=Loxodonta africana GN=CFTR PE=3 SV=1 195 824 9.0E-39
sp|P10089|HLYBC_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=3 SV=2 1201 1450 1.0E-38
sp|P08716|HLYBP_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 1201 1450 1.0E-38
sp|Q933I3|LKTB_MANGL Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia glucosida GN=lktB PE=3 SV=1 1201 1450 1.0E-38
sp|Q8FDZ8|HLYB_ECOL6 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hlyB PE=3 SV=1 1201 1450 1.0E-38
sp|Q2KYS6|MSBA_BORA1 Lipid A export ATP-binding/permease protein MsbA OS=Bordetella avium (strain 197N) GN=msbA PE=3 SV=1 1214 1438 1.0E-38
sp|P0C086|LKTB7_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 1201 1450 1.0E-38
sp|P0C087|LKB14_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 1201 1450 1.0E-38
sp|Q93FH0|LKB2A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=2 1201 1450 1.0E-38
sp|Q933E0|LKTB_BIBTR Leukotoxin translocation ATP-binding protein LktB OS=Bibersteinia trehalosi GN=lktB PE=3 SV=1 1201 1450 1.0E-38
sp|Q93FH6|LKB1B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 1201 1450 1.0E-38
sp|P16532|LKB1A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 1201 1450 1.0E-38
sp|Q93FH2|LKB13_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 1201 1450 1.0E-38
sp|Q47908|MSBA_FRANO Lipid A export ATP-binding/permease protein MsbA OS=Francisella novicida GN=msbA PE=3 SV=2 898 1438 2.0E-38
sp|P47261|Y015_MYCGE Putative ABC transporter ATP-binding protein MG015 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG015 PE=3 SV=1 988 1439 3.0E-38
sp|Q8DAV2|MSBA_VIBVU Lipid A export ATP-binding/permease protein MsbA OS=Vibrio vulnificus (strain CMCP6) GN=msbA PE=3 SV=1 974 1449 3.0E-38
sp|Q93FH3|LKB16_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 1201 1450 3.0E-38
sp|P26760|RTX1B_ACTPL Toxin RTX-I translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIB PE=1 SV=2 1201 1450 4.0E-38
sp|P55469|Y4GM_RHISN Uncharacterized ABC transporter ATP-binding protein y4gM OS=Rhizobium sp. (strain NGR234) GN=NGR_a03510 PE=3 SV=1 967 1450 4.0E-38
sp|Q9SGY1|AB10B_ARATH ABC transporter B family member 10 OS=Arabidopsis thaliana GN=ABCB10 PE=1 SV=2 638 1448 4.0E-38
sp|Q9M0M2|AB9B_ARATH ABC transporter B family member 9 OS=Arabidopsis thaliana GN=ABCB9 PE=3 SV=2 344 1448 4.0E-38
sp|Q93FG6|LKB2B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 1201 1450 4.0E-38
sp|Q2SIN5|MSBA_HAHCH Lipid A export ATP-binding/permease protein MsbA OS=Hahella chejuensis (strain KCTC 2396) GN=msbA PE=3 SV=1 987 1450 4.0E-38
sp|Q6AJW3|MSBA_DESPS Lipid A export ATP-binding/permease protein MsbA OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=msbA PE=3 SV=1 973 1439 5.0E-38
sp|Q7MJ07|MSBA_VIBVY Lipid A export ATP-binding/permease protein MsbA OS=Vibrio vulnificus (strain YJ016) GN=msbA PE=3 SV=2 974 1449 5.0E-38
sp|P55122|LKTB_PASSP Leukotoxin translocation ATP-binding protein LktB OS=Pasteurella haemolytica-like sp. (strain 5943B) GN=lktB PE=3 SV=1 1201 1450 6.0E-38
sp|Q8RY46|AB26B_ARATH ABC transporter B family member 26, chloroplastic OS=Arabidopsis thaliana GN=ABCB26 PE=2 SV=1 961 1456 7.0E-38
sp|P23702|LTXB_AGGAC Leukotoxin export ATP-binding protein LtxB OS=Aggregatibacter actinomycetemcomitans GN=ltxB PE=1 SV=1 1201 1450 7.0E-38
sp|Q12C33|MSBA_POLSJ Lipid A export ATP-binding/permease protein MsbA OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=msbA PE=3 SV=1 1133 1450 9.0E-38
sp|P75094|Y019_MYCPN Putative ABC transporter ATP-binding protein MG015 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_019 PE=3 SV=1 988 1439 9.0E-38
sp|Q2K342|NDVA_RHIEC Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ndvA PE=3 SV=2 1178 1437 2.0E-37
sp|Q54W24|ABCB4_DICDI ABC transporter B family member 4 OS=Dictyostelium discoideum GN=abcB4 PE=3 SV=1 974 1452 2.0E-37
sp|Q4QPI4|MSBA_HAEI8 Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus influenzae (strain 86-028NP) GN=msbA PE=3 SV=1 967 1449 2.0E-37
sp|Q1BUV6|MSBA_BURCA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia cenocepacia (strain AU 1054) GN=msbA PE=3 SV=2 1084 1439 2.0E-37
sp|Q8XXB6|MSBA_RALSO Lipid A export ATP-binding/permease protein MsbA OS=Ralstonia solanacearum (strain GMI1000) GN=msbA PE=3 SV=1 1049 1438 2.0E-37
sp|P26362|CFTR_SQUAC Cystic fibrosis transmembrane conductance regulator OS=Squalus acanthias GN=CFTR PE=1 SV=1 195 824 3.0E-37
sp|Q63VX7|MSBA_BURPS Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain K96243) GN=msbA PE=3 SV=1 1152 1438 3.0E-37
sp|Q3JUI6|MSBA_BURP1 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain 1710b) GN=msbA PE=3 SV=2 1152 1438 3.0E-37
sp|Q62IG3|MSBA_BURMA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia mallei (strain ATCC 23344) GN=msbA PE=3 SV=2 1152 1438 3.0E-37
sp|Q54BU4|ABCB1_DICDI ABC transporter B family member 1 OS=Dictyostelium discoideum GN=abcB1 PE=3 SV=1 974 1451 3.0E-37
sp|P97998|MDL1_CANAX ATP-dependent permease MDL1 OS=Candida albicans GN=MDL1 PE=3 SV=1 992 1448 4.0E-37
sp|P54719|YFIC_BACSU Uncharacterized ABC transporter ATP-binding protein YfiC OS=Bacillus subtilis (strain 168) GN=yfiC PE=3 SV=1 971 1450 4.0E-37
sp|Q2SZW0|MSBA_BURTA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=msbA PE=3 SV=1 1152 1438 5.0E-37
sp|Q7VWD8|MSBA_BORPE Lipid A export ATP-binding/permease protein MsbA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=msbA PE=3 SV=1 1194 1454 6.0E-37
sp|Q7W9N7|MSBA_BORPA Lipid A export ATP-binding/permease protein MsbA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=msbA PE=3 SV=1 1194 1454 6.0E-37
sp|Q7WH20|MSBA_BORBR Lipid A export ATP-binding/permease protein MsbA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=msbA PE=3 SV=2 1194 1454 6.0E-37
sp|P44407|MSBA_HAEIN Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=msbA PE=3 SV=1 967 1449 9.0E-37
sp|P59653|COMA_STRR6 Transport/processing ATP-binding protein ComA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=comA PE=3 SV=1 987 1438 9.0E-37
sp|Q1MAB5|NDVA_RHIL3 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ndvA PE=3 SV=1 1101 1437 1.0E-36
sp|Q04473|RTX3B_ACTPL Toxin RTX-III translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIIIB PE=3 SV=1 1201 1455 1.0E-36
sp|O31708|YKNV_BACSU Uncharacterized ABC transporter ATP-binding protein YknV OS=Bacillus subtilis (strain 168) GN=yknV PE=3 SV=1 1177 1438 1.0E-36
sp|Q8T9W2|ABCB5_DICDI ABC transporter B family member 5 OS=Dictyostelium discoideum GN=abcB5 PE=3 SV=1 970 1438 2.0E-36
sp|O07550|YHEI_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheI OS=Bacillus subtilis (strain 168) GN=yheI PE=1 SV=1 936 1451 2.0E-36
sp|Q03519|TAP2_HUMAN Antigen peptide transporter 2 OS=Homo sapiens GN=TAP2 PE=1 SV=1 974 1428 3.0E-36
sp|Q2IBA1|CFTR_CHLAE Cystic fibrosis transmembrane conductance regulator OS=Chlorocebus aethiops GN=CFTR PE=3 SV=1 195 824 4.0E-36
sp|Q39E73|MSBA_BURL3 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=msbA PE=3 SV=2 1084 1439 4.0E-36
sp|Q00564|LCNC_LACLL Lactococcin-A transport/processing ATP-binding protein LcnC OS=Lactococcus lactis subsp. lactis GN=lcnC PE=3 SV=1 987 1455 4.0E-36
sp|Q00553|CFTR_MACMU Cystic fibrosis transmembrane conductance regulator OS=Macaca mulatta GN=CFTR PE=2 SV=2 195 824 7.0E-36
sp|Q7JII7|CFTR_MACFU Cystic fibrosis transmembrane conductance regulator OS=Macaca fuscata fuscata GN=CFTR PE=3 SV=1 195 824 7.0E-36
sp|Q7JII8|CFTR_MACFA Cystic fibrosis transmembrane conductance regulator OS=Macaca fascicularis GN=CFTR PE=3 SV=1 195 824 7.0E-36
sp|Q9TSP5|CFTR_PAPAN Cystic fibrosis transmembrane conductance regulator OS=Papio anubis GN=CFTR PE=3 SV=1 195 824 7.0E-36
sp|Q9TUQ2|CFTR_MACNE Cystic fibrosis transmembrane conductance regulator OS=Macaca nemestrina GN=CFTR PE=3 SV=1 195 824 7.0E-36
sp|Q5NIG3|MSBA_FRATT Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=msbA PE=3 SV=1 974 1438 7.0E-36
sp|Q14JW6|MSBA_FRAT1 Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=msbA PE=1 SV=1 974 1438 7.0E-36
sp|Q21WN9|MSBA_RHOFT Lipid A export ATP-binding/permease protein MsbA OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=msbA PE=3 SV=1 1216 1439 7.0E-36
sp|Q9NP78|ABCB9_HUMAN ATP-binding cassette sub-family B member 9 OS=Homo sapiens GN=ABCB9 PE=1 SV=1 974 1452 7.0E-36
sp|Q09YH0|CFTR_SAIBB Cystic fibrosis transmembrane conductance regulator OS=Saimiri boliviensis boliviensis GN=CFTR PE=3 SV=1 195 824 9.0E-36
sp|Q2QLE5|CFTR_PANTR Cystic fibrosis transmembrane conductance regulator OS=Pan troglodytes GN=CFTR PE=3 SV=1 195 824 9.0E-36
sp|P13569|CFTR_HUMAN Cystic fibrosis transmembrane conductance regulator OS=Homo sapiens GN=CFTR PE=1 SV=3 195 824 1.0E-35
sp|P18767|NDVA_RHIME Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium meliloti (strain 1021) GN=ndvA PE=1 SV=2 1078 1437 1.0E-35
sp|P36372|TAP2_RAT Antigen peptide transporter 2 OS=Rattus norvegicus GN=Tap2 PE=2 SV=1 974 1451 1.0E-35
sp|Q0BKJ3|MSBA_FRATO Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=msbA PE=3 SV=1 974 1438 1.0E-35
sp|Q2A1U9|MSBA_FRATH Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain LVS) GN=msbA PE=3 SV=1 974 1438 1.0E-35
sp|Q1LQD3|MSBA_CUPMC Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=msbA PE=3 SV=1 1084 1438 1.0E-35
sp|Q9KQW9|MSBA_VIBCH Lipid A export ATP-binding/permease protein MsbA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=msbA PE=1 SV=1 979 1449 1.0E-35
sp|Q3KJ31|MSBA_PSEPF Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf0-1) GN=msbA PE=3 SV=1 976 1438 1.0E-35
sp|Q2NUA5|MSBA_SODGM Lipid A export ATP-binding/permease protein MsbA OS=Sodalis glossinidius (strain morsitans) GN=msbA PE=3 SV=1 933 1438 1.0E-35
sp|Q0A4U4|MSBA_ALKEH Lipid A export ATP-binding/permease protein MsbA OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=msbA PE=3 SV=1 952 1438 1.0E-35
sp|Q09YK5|CFTR_ATEGE Cystic fibrosis transmembrane conductance regulator OS=Ateles geoffroyi GN=CFTR PE=3 SV=1 195 824 2.0E-35
sp|Q6PQZ2|CFTR_PIG Cystic fibrosis transmembrane conductance regulator OS=Sus scrofa GN=CFTR PE=2 SV=1 195 824 2.0E-35
sp|Q2YU20|Y1799_STAAB Putative multidrug export ATP-binding/permease protein SAB1799c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB1799c PE=3 SV=1 1028 1449 2.0E-35
sp|P22638|HEPA_NOSS1 Heterocyst differentiation ATP-binding protein HepA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hepA PE=2 SV=3 972 1438 2.0E-35
sp|Q2G2M9|Y2003_STAA8 Putative multidrug export ATP-binding/permease protein SAOUHSC_02003 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02003 PE=3 SV=1 1028 1449 2.0E-35
sp|Q6GFJ1|Y1956_STAAR Putative multidrug export ATP-binding/permease protein SAR1956 OS=Staphylococcus aureus (strain MRSA252) GN=SAR1956 PE=3 SV=1 1028 1449 2.0E-35
sp|Q5HEQ8|Y1924_STAAC Putative multidrug export ATP-binding/permease protein SACOL1924 OS=Staphylococcus aureus (strain COL) GN=SACOL1924 PE=3 SV=1 1028 1449 2.0E-35
sp|Q99T13|Y1866_STAAM Putative multidrug export ATP-binding/permease protein SAV1866 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV1866 PE=1 SV=1 1028 1449 2.0E-35
sp|Q2FFM9|Y1847_STAA3 Putative multidrug export ATP-binding/permease protein SAUSA300_1847 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_1847 PE=3 SV=1 1028 1449 2.0E-35
sp|Q7A0J1|Y1806_STAAW Putative multidrug export ATP-binding/permease protein MW1806 OS=Staphylococcus aureus (strain MW2) GN=MW1806 PE=3 SV=1 1028 1449 2.0E-35
sp|Q6G868|Y1788_STAAS Putative multidrug export ATP-binding/permease protein SAS1788 OS=Staphylococcus aureus (strain MSSA476) GN=SAS1788 PE=3 SV=1 1028 1449 2.0E-35
sp|Q7A4T3|Y1683_STAAN Putative multidrug export ATP-binding/permease protein SA1683 OS=Staphylococcus aureus (strain N315) GN=SA1683 PE=1 SV=1 1028 1449 2.0E-35
sp|Q87R16|MSBA_VIBPA Lipid A export ATP-binding/permease protein MsbA OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=msbA PE=3 SV=1 978 1449 2.0E-35
sp|Q21NS8|MSBA_SACD2 Lipid A export ATP-binding/permease protein MsbA OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=msbA PE=3 SV=1 947 1438 2.0E-35
sp|Q9SYI2|AB3B_ARATH ABC transporter B family member 3 OS=Arabidopsis thaliana GN=ABCB3 PE=3 SV=1 636 1450 3.0E-35
sp|Q6LPK6|MSBA_PHOPR Lipid A export ATP-binding/permease protein MsbA OS=Photobacterium profundum GN=msbA PE=3 SV=1 979 1449 3.0E-35
sp|P36371|TAP2_MOUSE Antigen peptide transporter 2 OS=Mus musculus GN=Tap2 PE=1 SV=1 955 1451 3.0E-35
sp|Q07DY5|CFTR_COLGU Cystic fibrosis transmembrane conductance regulator OS=Colobus guereza GN=CFTR PE=3 SV=1 195 837 4.0E-35
sp|Q6F9X0|MSBA_ACIAD Lipid A export ATP-binding/permease protein MsbA OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=msbA PE=3 SV=1 1201 1451 4.0E-35
sp|Q83D84|MSBA_COXBU Lipid A export ATP-binding/permease protein MsbA OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=msbA PE=3 SV=1 1084 1449 6.0E-35
sp|Q4FS42|MSBA_PSYA2 Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=msbA PE=3 SV=1 882 1439 6.0E-35
sp|Q7VL52|MSBA_HAEDU Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=msbA PE=3 SV=1 1144 1449 7.0E-35
sp|Q6BXD7|ATM1_DEBHA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATM1 PE=3 SV=2 1217 1454 7.0E-35
sp|Q65U21|MSBA_MANSM Lipid A export ATP-binding/permease protein MsbA OS=Mannheimia succiniciproducens (strain MBEL55E) GN=msbA PE=3 SV=2 967 1450 8.0E-35
sp|P45861|YWJA_BACSU Uncharacterized ABC transporter ATP-binding protein YwjA OS=Bacillus subtilis (strain 168) GN=ywjA PE=3 SV=1 989 1438 8.0E-35
sp|Q03727|COMA_STRPN Transport/processing ATP-binding protein ComA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=comA PE=3 SV=3 987 1438 9.0E-35
sp|Q9JXR3|MSBA_NEIMB Lipid A export ATP-binding/permease protein MsbA OS=Neisseria meningitidis serogroup B (strain MC58) GN=msbA PE=3 SV=1 1205 1454 1.0E-34
sp|Q08D64|ABCB6_XENTR ATP-binding cassette sub-family B member 6, mitochondrial OS=Xenopus tropicalis GN=abcb6 PE=2 SV=1 1215 1438 1.0E-34
sp|Q8YH20|NDVA_BRUME Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ndvA PE=3 SV=1 1078 1437 1.0E-34
sp|P11599|HLYB_PROVU Alpha-hemolysin translocation ATP-binding protein HlyB OS=Proteus vulgaris GN=hlyB PE=3 SV=1 1201 1450 1.0E-34
sp|Q2QL74|CFTR_DIDVI Cystic fibrosis transmembrane conductance regulator OS=Didelphis virginiana GN=CFTR PE=3 SV=1 195 824 2.0E-34
sp|Q5D1Z7|CFTR_TRIVU Cystic fibrosis transmembrane conductance regulator OS=Trichosurus vulpecula GN=CFTR PE=2 SV=1 195 824 2.0E-34
sp|P40416|ATM1_YEAST Iron-sulfur clusters transporter ATM1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATM1 PE=1 SV=2 1218 1449 2.0E-34
sp|P70864|NDVA_BARBA Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella bacilliformis GN=ndvA PE=3 SV=2 1078 1451 2.0E-34
sp|Q9JJ59|ABCB9_MOUSE ATP-binding cassette sub-family B member 9 OS=Mus musculus GN=Abcb9 PE=2 SV=1 852 1452 2.0E-34
sp|P0DKX5|CYAB_BORPE Cyclolysin secretion/processing ATP-binding protein CyaB OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cyaB PE=3 SV=1 979 1438 2.0E-34
sp|Q8G0T8|NDVA_BRUSU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella suis biovar 1 (strain 1330) GN=ndvA PE=3 SV=1 1078 1437 2.0E-34
sp|P0DKX6|CYAB_BORP1 Cyclolysin secretion/processing ATP-binding protein CyaB OS=Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) GN=cyaB PE=3 SV=1 979 1438 2.0E-34
sp|Q5F4X8|MSBA_NEIG1 Lipid A export ATP-binding/permease protein MsbA OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=msbA PE=3 SV=1 1205 1438 3.0E-34
sp|A1USS5|NDVA_BARBK Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ndvA PE=3 SV=1 1078 1450 3.0E-34
sp|Q9CJB8|LCNCL_LACLA Lactococcin transport/processing ATP-binding protein LcnC-like OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lcnC PE=3 SV=1 987 1450 3.0E-34
sp|Q9JW59|MSBA_NEIMA Lipid A export ATP-binding/permease protein MsbA OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=msbA PE=3 SV=1 1205 1454 3.0E-34
sp|P0C529|NDVA_BRUAB Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella abortus biovar 1 (strain 9-941) GN=ndvA PE=3 SV=1 1078 1437 3.0E-34
sp|Q2YQ73|NDVA_BRUA2 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella abortus (strain 2308) GN=ndvA PE=1 SV=1 1078 1437 3.0E-34
sp|O80725|AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana GN=ABCB4 PE=1 SV=1 972 1448 4.0E-34
sp|Q5RFQ9|ABCB8_PONAB ATP-binding cassette sub-family B member 8, mitochondrial OS=Pongo abelii GN=ABCB8 PE=2 SV=1 979 1439 4.0E-34
sp|Q9QYJ4|ABCB9_RAT ATP-binding cassette sub-family B member 9 OS=Rattus norvegicus GN=Abcb9 PE=1 SV=1 974 1452 4.0E-34
sp|B5X0E4|ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus GN=Abcb5 PE=2 SV=1 1200 1446 7.0E-34
sp|Q89A96|MDLB_BUCBP Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mdlB PE=3 SV=1 892 1449 8.0E-34
sp|Q02592|HMT1_SCHPO Heavy metal tolerance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hmt1 PE=2 SV=3 1195 1449 9.0E-34
sp|Q87VF3|MSBA_PSESM Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=msbA PE=3 SV=2 976 1438 9.0E-34
sp|Q07E42|CFTR_DASNO Cystic fibrosis transmembrane conductance regulator OS=Dasypus novemcinctus GN=CFTR PE=3 SV=1 195 824 1.0E-33
sp|Q3SFZ6|MSBA_THIDA Lipid A export ATP-binding/permease protein MsbA OS=Thiobacillus denitrificans (strain ATCC 25259) GN=msbA PE=3 SV=1 1146 1438 1.0E-33
sp|Q00552|CFTR_CAVPO Cystic fibrosis transmembrane conductance regulator OS=Cavia porcellus GN=CFTR PE=2 SV=2 195 824 2.0E-33
sp|Q88D92|MSBA_PSEPK Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas putida (strain KT2440) GN=msbA PE=3 SV=1 976 1438 2.0E-33
sp|Q9HUG8|MSBA_PSEAE Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=msbA PE=3 SV=1 1199 1438 2.0E-33
sp|Q5P2S7|MSBA_AROAE Lipid A export ATP-binding/permease protein MsbA OS=Aromatoleum aromaticum (strain EbN1) GN=msbA PE=3 SV=1 977 1438 2.0E-33
sp|O75027|ABCB7_HUMAN ATP-binding cassette sub-family B member 7, mitochondrial OS=Homo sapiens GN=ABCB7 PE=1 SV=2 1214 1457 2.0E-33
sp|Q61102|ABCB7_MOUSE ATP-binding cassette sub-family B member 7, mitochondrial OS=Mus musculus GN=Abcb7 PE=1 SV=3 1214 1457 2.0E-33
sp|Q492S9|MSBA_BLOPB Lipid A export ATP-binding/permease protein MsbA OS=Blochmannia pennsylvanicus (strain BPEN) GN=msbA PE=3 SV=1 979 1450 3.0E-33
sp|Q46Y89|MSBA_CUPPJ Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=msbA PE=3 SV=1 1199 1438 3.0E-33
sp|Q12M46|MSBA_SHEDO Lipid A export ATP-binding/permease protein MsbA OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=msbA PE=3 SV=1 984 1450 3.0E-33
sp|P0AAG5|MDLB_ECOLI Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli (strain K12) GN=mdlB PE=1 SV=1 979 1438 4.0E-33
sp|P0AAG6|MDLB_ECOL6 Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdlB PE=3 SV=1 979 1438 4.0E-33
sp|P0AAG7|MDLB_ECO57 Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli O157:H7 GN=mdlB PE=3 SV=1 979 1438 4.0E-33
sp|Q8T9W4|ABCB3_DICDI ABC transporter B family member 3 OS=Dictyostelium discoideum GN=abcB3 PE=3 SV=1 869 1451 4.0E-33
sp|Q31FG2|MSBA_THICR Lipid A export ATP-binding/permease protein MsbA OS=Thiomicrospira crunogena (strain XCL-2) GN=msbA PE=3 SV=1 1055 1451 4.0E-33
sp|Q9NUT2|ABCB8_HUMAN ATP-binding cassette sub-family B member 8, mitochondrial OS=Homo sapiens GN=ABCB8 PE=1 SV=3 979 1439 5.0E-33
sp|Q07E16|CFTR_MUSPF Cystic fibrosis transmembrane conductance regulator OS=Mustela putorius furo GN=CFTR PE=3 SV=1 195 824 8.0E-33
sp|Q59R09|ATM1_CANAL Iron-sulfur clusters transporter ATM1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATM1 PE=3 SV=1 1217 1454 9.0E-33
sp|P0A2V1|NDVA_RHIRD Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium radiobacter GN=ndvA PE=1 SV=1 1184 1437 1.0E-32
sp|P0A2V0|NDVA_AGRFC Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ndvA PE=3 SV=1 1184 1437 1.0E-32
sp|Q5RKI8|ABCB8_RAT ATP-binding cassette sub-family B member 8, mitochondrial OS=Rattus norvegicus GN=Abcb8 PE=2 SV=1 979 1439 1.0E-32
sp|Q9CMG7|MSBA_PASMU Lipid A export ATP-binding/permease protein MsbA OS=Pasteurella multocida (strain Pm70) GN=msbA PE=3 SV=1 984 1450 1.0E-32
sp|Q704E8|ABCB7_RAT ATP-binding cassette sub-family B member 7, mitochondrial OS=Rattus norvegicus GN=Abcb7 PE=1 SV=1 1214 1450 1.0E-32
sp|Q9M1Q9|AB21B_ARATH ABC transporter B family member 21 OS=Arabidopsis thaliana GN=ABCB21 PE=1 SV=2 972 1448 1.0E-32
sp|P35071|CFTR_BOVIN Cystic fibrosis transmembrane conductance regulator OS=Bos taurus GN=CFTR PE=2 SV=2 195 837 2.0E-32
sp|Q7NZU6|MSBA_CHRVO Lipid A export ATP-binding/permease protein MsbA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=msbA PE=3 SV=1 1079 1438 2.0E-32
sp|Q56A55|ABCB8_DANRE ATP-binding cassette sub-family B member 8, mitochondrial OS=Danio rerio GN=abcb8 PE=2 SV=1 979 1455 2.0E-32
sp|Q983H5|NDVA_RHILO Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium loti (strain MAFF303099) GN=ndvA PE=3 SV=1 1217 1437 2.0E-32
sp|Q6FIK3|ATM1_CANGA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATM1 PE=3 SV=1 1218 1449 2.0E-32
sp|Q9SYI3|AB5B_ARATH ABC transporter B family member 5 OS=Arabidopsis thaliana GN=ABCB5 PE=3 SV=1 928 1448 2.0E-32
sp|Q5ZUH9|MSBA_LEGPH Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=msbA PE=3 SV=2 1084 1450 3.0E-32
sp|Q9CXJ4|ABCB8_MOUSE ATP-binding cassette sub-family B member 8, mitochondrial OS=Mus musculus GN=Abcb8 PE=1 SV=1 979 1439 3.0E-32
sp|Q48P40|MSBA_PSE14 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=msbA PE=3 SV=2 976 1438 3.0E-32
sp|Q1QBW0|MSBA_PSYCK Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter cryohalolentis (strain K5) GN=msbA PE=3 SV=1 882 1439 4.0E-32
sp|Q2M3G0|ABCB5_HUMAN ATP-binding cassette sub-family B member 5 OS=Homo sapiens GN=ABCB5 PE=1 SV=4 1216 1454 4.0E-32
sp|Q9ZCM8|Y696_RICPR Putative export ATP-binding/permease protein RP696 OS=Rickettsia prowazekii (strain Madrid E) GN=RP696 PE=3 SV=1 997 1442 4.0E-32
sp|Q6D437|MSBA_PECAS Lipid A export ATP-binding/permease protein MsbA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=msbA PE=3 SV=2 979 1449 5.0E-32
sp|Q2LVL0|MSBA_SYNAS Lipid A export ATP-binding/permease protein MsbA OS=Syntrophus aciditrophicus (strain SB) GN=msbA PE=3 SV=1 935 1438 5.0E-32
sp|B5X0E4|ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus GN=Abcb5 PE=2 SV=1 1070 1438 6.0E-32
sp|Q46717|HLYB_ECO57 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O157:H7 GN=hlyB PE=3 SV=2 1201 1450 6.0E-32
sp|P9WQJ7|IRTB_MYCTU Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtB PE=1 SV=1 1218 1457 6.0E-32
sp|P9WQJ6|IRTB_MYCTO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtB PE=3 SV=1 1218 1457 6.0E-32
sp|P63394|IRTB_MYCBO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtB PE=3 SV=1 1218 1457 6.0E-32
sp|Q080T2|MSBA_SHEFN Lipid A export ATP-binding/permease protein MsbA OS=Shewanella frigidimarina (strain NCIMB 400) GN=msbA PE=3 SV=1 984 1438 6.0E-32
sp|Q3SP57|NDVA_NITWN Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=ndvA PE=3 SV=2 1137 1438 7.0E-32
sp|Q9FWX7|AB11B_ARATH ABC transporter B family member 11 OS=Arabidopsis thaliana GN=ABCB11 PE=2 SV=1 1206 1448 8.0E-32
sp|Q4KJB2|MSBA_PSEF5 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=msbA PE=3 SV=1 976 1438 9.0E-32
sp|Q5X498|MSBA_LEGPA Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila (strain Paris) GN=msbA PE=3 SV=1 1201 1450 9.0E-32
sp|Q60AA3|MSBA_METCA Lipid A export ATP-binding/permease protein MsbA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=msbA PE=3 SV=1 987 1449 9.0E-32
sp|Q5U820|CFTR_CANLF Cystic fibrosis transmembrane conductance regulator OS=Canis lupus familiaris GN=CFTR PE=2 SV=2 195 824 1.0E-31
sp|Q1QX69|MSBA_CHRSD Lipid A export ATP-binding/permease protein MsbA OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=msbA PE=3 SV=1 1216 1450 1.0E-31
sp|Q3IGX5|MSBA_PSEHT Lipid A export ATP-binding/permease protein MsbA OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=msbA PE=3 SV=1 973 1438 1.0E-31
sp|Q3J7R8|MSBA_NITOC Lipid A export ATP-binding/permease protein MsbA OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=msbA PE=3 SV=1 1217 1457 1.0E-31
sp|Q9FHF1|AB7B_ARATH ABC transporter B family member 7 OS=Arabidopsis thaliana GN=ABCB7 PE=3 SV=1 974 1448 1.0E-31
sp|Q1RJ91|Y492_RICBR Putative export ATP-binding/permease protein RBE_0492 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0492 PE=3 SV=1 997 1452 1.0E-31
sp|Q1RDU4|MSBA_ECOUT Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli (strain UTI89 / UPEC) GN=msbA PE=3 SV=1 967 1438 1.0E-31
sp|Q8FJB1|MSBA_ECOL6 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=msbA PE=3 SV=1 967 1438 1.0E-31
sp|Q0TJD9|MSBA_ECOL5 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=msbA PE=3 SV=1 967 1438 1.0E-31
sp|Q83LP0|MSBA_SHIFL Lipid A export ATP-binding/permease protein MsbA OS=Shigella flexneri GN=msbA PE=3 SV=1 967 1438 1.0E-31
sp|Q07DW5|CFTR_MUNRE Cystic fibrosis transmembrane conductance regulator OS=Muntiacus reevesi GN=CFTR PE=3 SV=1 195 837 2.0E-31
sp|Q09YJ4|CFTR_MUNMU Cystic fibrosis transmembrane conductance regulator OS=Muntiacus muntjak GN=CFTR PE=3 SV=1 195 837 2.0E-31
sp|Q9M0M2|AB9B_ARATH ABC transporter B family member 9 OS=Arabidopsis thaliana GN=ABCB9 PE=3 SV=2 941 1448 2.0E-31
sp|Q9SYI2|AB3B_ARATH ABC transporter B family member 3 OS=Arabidopsis thaliana GN=ABCB3 PE=3 SV=1 972 1448 2.0E-31
sp|Q66CI3|MSBA_YERPS Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=msbA PE=3 SV=1 935 1438 2.0E-31
sp|Q1CGH0|MSBA_YERPN Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=msbA PE=3 SV=1 935 1438 2.0E-31
sp|Q8ZGA9|MSBA_YERPE Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis GN=msbA PE=3 SV=1 935 1438 2.0E-31
sp|Q1CA68|MSBA_YERPA Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=msbA PE=3 SV=1 935 1438 2.0E-31
sp|Q32E34|MSBA_SHIDS Lipid A export ATP-binding/permease protein MsbA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=msbA PE=3 SV=1 967 1438 2.0E-31
sp|Q31YT6|MSBA_SHIBS Lipid A export ATP-binding/permease protein MsbA OS=Shigella boydii serotype 4 (strain Sb227) GN=msbA PE=3 SV=1 967 1438 2.0E-31
sp|P60752|MSBA_ECOLI Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli (strain K12) GN=msbA PE=1 SV=1 967 1438 2.0E-31
sp|P60753|MSBA_ECO57 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O157:H7 GN=msbA PE=3 SV=1 967 1438 2.0E-31
sp|Q9C7F2|AB14B_ARATH ABC transporter B family member 14 OS=Arabidopsis thaliana GN=ABCB14 PE=3 SV=1 1216 1448 2.0E-31
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 972 1455 2.0E-31
sp|Q2ULH4|ATM1_ASPOR Iron-sulfur clusters transporter atm1, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atm1 PE=3 SV=1 1217 1449 2.0E-31
sp|Q5WVN2|MSBA_LEGPL Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila (strain Lens) GN=msbA PE=3 SV=1 1201 1450 2.0E-31
sp|Q3Z3K7|MSBA_SHISS Lipid A export ATP-binding/permease protein MsbA OS=Shigella sonnei (strain Ss046) GN=msbA PE=3 SV=1 967 1438 2.0E-31
sp|Q68W42|Y691_RICTY Putative export ATP-binding/permease protein RT0691 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=RT0691 PE=3 SV=1 997 1442 2.0E-31
sp|Q8K984|MDLB_BUCAP Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=mdlB PE=3 SV=1 979 1439 3.0E-31
sp|Q5B1Q2|ATM1_EMENI Iron-sulfur clusters transporter atm1, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atm1 PE=3 SV=2 1212 1449 3.0E-31
sp|Q9M0G9|AB24B_ARATH ABC transporter B family member 24, mitochondrial OS=Arabidopsis thaliana GN=ABCB24 PE=2 SV=1 1217 1438 3.0E-31
sp|P63359|MSBA_SALTY Lipid A export ATP-binding/permease protein MsbA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=msbA PE=1 SV=1 967 1438 3.0E-31
sp|P63360|MSBA_SALTI Lipid A export ATP-binding/permease protein MsbA OS=Salmonella typhi GN=msbA PE=3 SV=1 967 1438 3.0E-31
sp|Q57R14|MSBA_SALCH Lipid A export ATP-binding/permease protein MsbA OS=Salmonella choleraesuis (strain SC-B67) GN=msbA PE=3 SV=1 967 1438 3.0E-31
sp|Q9C7F8|AB13B_ARATH ABC transporter B family member 13 OS=Arabidopsis thaliana GN=ABCB13 PE=3 SV=1 1216 1448 3.0E-31
sp|Q9C7F8|AB13B_ARATH ABC transporter B family member 13 OS=Arabidopsis thaliana GN=ABCB13 PE=3 SV=1 1217 1444 3.0E-31
sp|Q0I4C5|MSBA_HAES1 Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus somnus (strain 129Pt) GN=msbA PE=3 SV=1 1216 1455 3.0E-31
sp|Q9DC29|ABCB6_MOUSE ATP-binding cassette sub-family B member 6, mitochondrial OS=Mus musculus GN=Abcb6 PE=1 SV=1 1215 1450 3.0E-31
sp|Q5PGH0|MSBA_SALPA Lipid A export ATP-binding/permease protein MsbA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=msbA PE=3 SV=1 967 1438 3.0E-31
sp|Q9FNU2|AB25B_ORYSJ ABC transporter B family member 25 OS=Oryza sativa subsp. japonica GN=OsABCB25 PE=2 SV=1 930 1438 3.0E-31
sp|P26363|CFTR_XENLA Cystic fibrosis transmembrane conductance regulator OS=Xenopus laevis GN=cftr PE=2 SV=1 195 824 4.0E-31
sp|Q9LSJ6|AB17B_ARATH ABC transporter B family member 17 OS=Arabidopsis thaliana GN=ABCB17 PE=3 SV=1 1172 1438 4.0E-31
sp|Q9LJX0|AB19B_ARATH ABC transporter B family member 19 OS=Arabidopsis thaliana GN=ABCB19 PE=1 SV=1 638 1450 5.0E-31
sp|Q9SGY1|AB10B_ARATH ABC transporter B family member 10 OS=Arabidopsis thaliana GN=ABCB10 PE=1 SV=2 1217 1448 6.0E-31
sp|Q6FZF2|NDVA_BARQU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella quintana (strain Toulouse) GN=ndvA PE=3 SV=1 1078 1438 6.0E-31
sp|Q6CX96|ATM1_KLULA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATM1 PE=3 SV=1 1218 1454 6.0E-31
sp|Q20Z38|NDVA_RHOPB Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisB18) GN=ndvA PE=3 SV=1 1049 1438 7.0E-31
sp|Q8LPK2|AB2B_ARATH ABC transporter B family member 2 OS=Arabidopsis thaliana GN=ABCB2 PE=1 SV=3 1216 1448 7.0E-31
sp|Q4ZZ16|MSBA_PSEU2 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas syringae pv. syringae (strain B728a) GN=msbA PE=3 SV=1 976 1438 7.0E-31
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 1074 1446 7.0E-31
sp|Q483B6|MSBA1_COLP3 Lipid A export ATP-binding/permease protein MsbA 1 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=msbA1 PE=3 SV=1 979 1449 7.0E-31
sp|O70595|ABCB6_RAT ATP-binding cassette sub-family B member 6, mitochondrial OS=Rattus norvegicus GN=Abcb6 PE=2 SV=1 1215 1450 8.0E-31
sp|Q9C7F2|AB14B_ARATH ABC transporter B family member 14 OS=Arabidopsis thaliana GN=ABCB14 PE=3 SV=1 1199 1438 1.0E-30
sp|Q47JR8|MSBA_DECAR Lipid A export ATP-binding/permease protein MsbA OS=Dechloromonas aromatica (strain RCB) GN=msbA PE=3 SV=1 899 1449 1.0E-30
sp|P57552|MDLB_BUCAI Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mdlB PE=3 SV=1 1166 1450 1.0E-30
sp|Q6G2Z5|NDVA_BARHE Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ndvA PE=3 SV=1 1078 1438 1.0E-30
sp|Q9NP58|ABCB6_HUMAN ATP-binding cassette sub-family B member 6, mitochondrial OS=Homo sapiens GN=ABCB6 PE=1 SV=1 1215 1438 2.0E-30
sp|Q9Y7M7|MDL1_SCHPO ATP-dependent permease MDL1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdl1 PE=3 SV=1 974 1446 2.0E-30
sp|P9WQJ9|IRTA_MYCTU Iron import ATP-binding/permease protein IrtA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtA PE=1 SV=1 1214 1438 2.0E-30
sp|P9WQJ8|IRTA_MYCTO Iron import ATP-binding/permease protein IrtA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtA PE=3 SV=1 1214 1438 2.0E-30
sp|P63392|IRTA_MYCBO Iron import ATP-binding/permease protein IrtA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtA PE=3 SV=1 1214 1438 2.0E-30
sp|P71082|YGAD_BACSU Putative multidrug export ATP-binding/permease protein YgaD OS=Bacillus subtilis (strain 168) GN=ygaD PE=3 SV=2 1056 1449 2.0E-30
sp|Q5QU36|MSBA_IDILO Lipid A export ATP-binding/permease protein MsbA OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=msbA PE=3 SV=1 1199 1446 2.0E-30
sp|P34713|PGP3_CAEEL Multidrug resistance protein pgp-3 OS=Caenorhabditis elegans GN=pgp-3 PE=2 SV=2 638 1452 2.0E-30
sp|Q10418|MESD_LEUME Mesentericin-Y105 transport/processing ATP-binding protein MesD OS=Leuconostoc mesenteroides GN=mesD PE=3 SV=1 987 1439 2.0E-30
sp|Q8D2U8|MSBA_WIGBR Lipid A export ATP-binding/permease protein MsbA OS=Wigglesworthia glossinidia brevipalpis GN=msbA PE=3 SV=1 979 1438 2.0E-30
sp|Q8EDF0|MSBA_SHEON Lipid A export ATP-binding/permease protein MsbA OS=Shewanella oneidensis (strain MR-1) GN=msbA PE=3 SV=1 987 1450 2.0E-30
sp|Q2M3G0|ABCB5_HUMAN ATP-binding cassette sub-family B member 5 OS=Homo sapiens GN=ABCB5 PE=1 SV=4 853 1452 3.0E-30
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 1217 1455 3.0E-30
sp|P59852|LAGD_LACLL Lactococcin-G-processing and transport ATP-binding protein LagD OS=Lactococcus lactis subsp. lactis GN=lagD PE=1 SV=1 987 1437 3.0E-30
sp|P36619|PMD1_SCHPO Leptomycin B resistance protein pmd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmd1 PE=3 SV=2 1204 1439 3.0E-30
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 1074 1446 4.0E-30
sp|Q9FUT3|AB23B_ARATH ABC transporter B family member 23, mitochondrial OS=Arabidopsis thaliana GN=ABCB23 PE=2 SV=1 1217 1438 4.0E-30
sp|Q08201|MDR3_RAT Phosphatidylcholine translocator ABCB4 OS=Rattus norvegicus GN=Abcb4 PE=1 SV=1 1213 1438 4.0E-30
sp|Q0HTS8|MSBA_SHESR Lipid A export ATP-binding/permease protein MsbA OS=Shewanella sp. (strain MR-7) GN=msbA PE=3 SV=1 987 1450 5.0E-30
sp|Q0HHH4|MSBA_SHESM Lipid A export ATP-binding/permease protein MsbA OS=Shewanella sp. (strain MR-4) GN=msbA PE=3 SV=1 987 1450 5.0E-30
sp|Q9CHL8|LMRA_LACLA Multidrug resistance ABC transporter ATP-binding and permease protein OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lmrA PE=1 SV=2 987 1440 5.0E-30
sp|Q00555|CFTR_SHEEP Cystic fibrosis transmembrane conductance regulator OS=Ovis aries GN=CFTR PE=1 SV=2 195 837 6.0E-30
sp|Q15UY7|MSBA_PSEA6 Lipid A export ATP-binding/permease protein MsbA OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=msbA PE=3 SV=1 1170 1450 6.0E-30
sp|Q4UMZ3|Y214_RICFE Putative export ATP-binding/permease protein RF_0214 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0214 PE=3 SV=2 997 1442 8.0E-30
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 1217 1455 8.0E-30
sp|Q5E0F2|MSBA_VIBF1 Lipid A export ATP-binding/permease protein MsbA OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=msbA PE=3 SV=1 974 1449 8.0E-30
sp|Q54BT3|ABCB2_DICDI ABC transporter B family member 2 OS=Dictyostelium discoideum GN=abcB2 PE=3 SV=1 1216 1454 1.0E-29
sp|Q92GP9|Y1073_RICCN Putative export ATP-binding/permease protein RC1073 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=RC1073 PE=3 SV=1 997 1442 1.0E-29
sp|Q1QH37|NDVA_NITHX Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=ndvA PE=3 SV=1 1137 1438 1.0E-29
sp|P54718|YFIB_BACSU Uncharacterized ABC transporter ATP-binding protein YfiB OS=Bacillus subtilis (strain 168) GN=yfiB PE=3 SV=1 1189 1450 1.0E-29
sp|Q2QLC5|CFTR_CARPS Cystic fibrosis transmembrane conductance regulator OS=Carollia perspicillata GN=CFTR PE=3 SV=1 195 824 2.0E-29
sp|Q13BH6|NDVA_RHOPS Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisB5) GN=ndvA PE=3 SV=1 1137 1438 2.0E-29
sp|Q6YUU5|MDR_ORYSJ Putative multidrug resistance protein OS=Oryza sativa subsp. japonica GN=Os02g0190300 PE=3 SV=1 1216 1438 3.0E-29
sp|P33310|MDL1_YEAST ATP-dependent permease MDL1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDL1 PE=1 SV=2 945 1448 3.0E-29
sp|Q9LJX0|AB19B_ARATH ABC transporter B family member 19 OS=Arabidopsis thaliana GN=ABCB19 PE=1 SV=1 1216 1438 5.0E-29
sp|Q00449|MDR49_DROME Multidrug resistance protein homolog 49 OS=Drosophila melanogaster GN=Mdr49 PE=2 SV=2 924 1438 5.0E-29
sp|P71355|Y663_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_0663 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0663 PE=3 SV=1 1080 1454 5.0E-29
sp|Q6N1Y7|NDVA_RHOPA Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ndvA PE=3 SV=1 1041 1448 5.0E-29
sp|P0CL92|ATM1_CRYNJ Iron-sulfur clusters transporter ATM1, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATM1 PE=3 SV=1 1217 1450 5.0E-29
sp|P0CL93|ATM1_CRYNB Iron-sulfur clusters transporter ATM1, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATM1 PE=3 SV=1 1217 1450 6.0E-29
sp|P21958|TAP1_MOUSE Antigen peptide transporter 1 OS=Mus musculus GN=Tap1 PE=1 SV=3 959 1452 6.0E-29
sp|P97046|LMRA_LACLM Multidrug resistance ABC transporter ATP-binding and permease protein OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=lmrA PE=3 SV=3 987 1440 6.0E-29
sp|Q2IBB3|CFTR_RHIFE Cystic fibrosis transmembrane conductance regulator OS=Rhinolophus ferrumequinum GN=CFTR PE=3 SV=1 195 824 7.0E-29
sp|Q9LSJ6|AB17B_ARATH ABC transporter B family member 17 OS=Arabidopsis thaliana GN=ABCB17 PE=3 SV=1 1183 1448 7.0E-29
sp|Q9LSJ2|AB22B_ARATH ABC transporter B family member 22 OS=Arabidopsis thaliana GN=ABCB22 PE=3 SV=2 1183 1448 7.0E-29
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 1213 1438 7.0E-29
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 930 1446 8.0E-29
sp|P0A4W5|Y1304_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb1304c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1304c PE=3 SV=1 1217 1438 8.0E-29
sp|P9WQJ1|Y1273_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1273c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1273c PE=1 SV=1 1217 1438 8.0E-29
sp|Q6C6N0|ATM1_YARLI Iron-sulfur clusters transporter ATM1, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATM1 PE=3 SV=1 1216 1450 8.0E-29
sp|P9WQJ0|Y1273_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1311 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1311 PE=3 SV=1 1217 1438 9.0E-29
sp|P34713|PGP3_CAEEL Multidrug resistance protein pgp-3 OS=Caenorhabditis elegans GN=pgp-3 PE=2 SV=2 1216 1445 1.0E-28
sp|Q9LVM1|AB25B_ARATH ABC transporter B family member 25, mitochondrial OS=Arabidopsis thaliana GN=ABCB25 PE=1 SV=1 1217 1438 1.0E-28
sp|P77265|MDLA_ECOLI Multidrug resistance-like ATP-binding protein MdlA OS=Escherichia coli (strain K12) GN=mdlA PE=3 SV=1 1155 1449 1.0E-28
sp|Q7VR44|MSBA_BLOFL Lipid A export ATP-binding/permease protein MsbA OS=Blochmannia floridanus GN=msbA PE=3 SV=1 977 1450 1.0E-28
sp|Q2G506|ATM1_NOVAD ATM1-type heavy metal exporter OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=atm1 PE=1 SV=1 1219 1451 1.0E-28
sp|P23174|MDR3_CRIGR Phosphatidylcholine translocator ABCB4 OS=Cricetulus griseus GN=ABCB4 PE=2 SV=1 1213 1438 1.0E-28
sp|P23886|CYDC_ECOLI ATP-binding/permease protein CydC OS=Escherichia coli (strain K12) GN=cydC PE=3 SV=2 997 1438 2.0E-28
sp|P33311|MDL2_YEAST ATP-dependent permease MDL2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDL2 PE=1 SV=3 1173 1448 2.0E-28
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 1216 1438 3.0E-28
sp|Q9LSJ2|AB22B_ARATH ABC transporter B family member 22 OS=Arabidopsis thaliana GN=ABCB22 PE=3 SV=2 1214 1438 3.0E-28
sp|Q751N2|ATM1_ASHGO Iron-sulfur clusters transporter ATM1, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATM1 PE=3 SV=1 1218 1454 3.0E-28
sp|Q9ZR72|AB1B_ARATH ABC transporter B family member 1 OS=Arabidopsis thaliana GN=ABCB1 PE=1 SV=1 1204 1452 3.0E-28
sp|Q480N3|MSBA2_COLP3 Lipid A export ATP-binding/permease protein MsbA 2 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=msbA2 PE=3 SV=2 1179 1450 3.0E-28
sp|Q7N6C6|MSBA_PHOLL Lipid A export ATP-binding/permease protein MsbA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=msbA PE=3 SV=1 979 1438 3.0E-28
sp|Q7RX59|ATM1_NEUCR Iron-sulfur clusters transporter atm1, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fes-4 PE=3 SV=1 1217 1438 4.0E-28
sp|B2GUP8|ABCB8_XENTR ATP-binding cassette sub-family B member 8, mitochondrial OS=Xenopus tropicalis GN=abcb8 PE=2 SV=1 979 1439 4.0E-28
sp|Q2J0F4|NDVA_RHOP2 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain HaA2) GN=ndvA PE=3 SV=1 1049 1438 6.0E-28
sp|O06967|BMRA_BACSU Multidrug resistance ABC transporter ATP-binding/permease protein BmrA OS=Bacillus subtilis (strain 168) GN=bmrA PE=1 SV=1 975 1457 6.0E-28
sp|Q89UT8|NDVA_BRADU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ndvA PE=3 SV=1 1137 1438 6.0E-28
sp|O80725|AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana GN=ABCB4 PE=1 SV=1 1203 1450 7.0E-28
sp|Q9M1Q9|AB21B_ARATH ABC transporter B family member 21 OS=Arabidopsis thaliana GN=ABCB21 PE=1 SV=2 1203 1450 8.0E-28
sp|Q08201|MDR3_RAT Phosphatidylcholine translocator ABCB4 OS=Rattus norvegicus GN=Abcb4 PE=1 SV=1 1204 1446 8.0E-28
sp|Q00449|MDR49_DROME Multidrug resistance protein homolog 49 OS=Drosophila melanogaster GN=Mdr49 PE=2 SV=2 1216 1452 8.0E-28
sp|O14286|ATM1_SCHPO Iron-sulfur clusters transporter atm1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atm1 PE=3 SV=2 1217 1438 8.0E-28
sp|Q07QX6|NDVA_RHOP5 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisA53) GN=ndvA PE=3 SV=1 1049 1438 8.0E-28
sp|Q9FWX8|AB12B_ARATH ABC transporter B family member 12 OS=Arabidopsis thaliana GN=ABCB12 PE=2 SV=2 1206 1448 8.0E-28
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 1216 1438 9.0E-28
sp|Q9LHD1|AB15B_ARATH ABC transporter B family member 15 OS=Arabidopsis thaliana GN=ABCB15 PE=3 SV=1 1217 1448 9.0E-28
sp|P34712|PGP1_CAEEL Multidrug resistance protein pgp-1 OS=Caenorhabditis elegans GN=pgp-1 PE=1 SV=2 1216 1438 1.0E-27
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 1216 1438 1.0E-27
sp|Q9LSJ5|AB18B_ARATH ABC transporter B family member 18 OS=Arabidopsis thaliana GN=ABCB18 PE=3 SV=1 1217 1448 1.0E-27
sp|Q4HVU7|ATM1_GIBZE Iron-sulfur clusters transporter ATM1, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ATM1 PE=3 SV=1 1217 1449 1.0E-27
sp|P36370|TAP1_RAT Antigen peptide transporter 1 OS=Rattus norvegicus GN=Tap1 PE=1 SV=2 959 1452 1.0E-27
sp|O95342|ABCBB_HUMAN Bile salt export pump OS=Homo sapiens GN=ABCB11 PE=1 SV=2 1208 1446 1.0E-27
sp|Q9ZR72|AB1B_ARATH ABC transporter B family member 1 OS=Arabidopsis thaliana GN=ABCB1 PE=1 SV=1 1217 1440 2.0E-27
sp|O70127|ABCBB_RAT Bile salt export pump OS=Rattus norvegicus GN=Abcb11 PE=1 SV=1 1201 1446 2.0E-27
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 1216 1438 3.0E-27
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 1216 1438 3.0E-27
sp|Q9LSJ8|AB16B_ARATH ABC transporter B family member 16 OS=Arabidopsis thaliana GN=ABCB16 PE=2 SV=1 1183 1438 3.0E-27
sp|Q54RU1|ABCB6_DICDI ABC transporter B family member 6 OS=Dictyostelium discoideum GN=abcB6 PE=3 SV=1 1219 1438 3.0E-27
sp|Q00554|CFTR_RABIT Cystic fibrosis transmembrane conductance regulator OS=Oryctolagus cuniculus GN=CFTR PE=2 SV=4 616 824 4.0E-27
sp|Q9LSJ8|AB16B_ARATH ABC transporter B family member 16 OS=Arabidopsis thaliana GN=ABCB16 PE=2 SV=1 1172 1438 4.0E-27
sp|Q9FWX8|AB12B_ARATH ABC transporter B family member 12 OS=Arabidopsis thaliana GN=ABCB12 PE=2 SV=2 1205 1450 6.0E-27
sp|P21439|MDR3_HUMAN Phosphatidylcholine translocator ABCB4 OS=Homo sapiens GN=ABCB4 PE=1 SV=2 1204 1438 6.0E-27
sp|P21439|MDR3_HUMAN Phosphatidylcholine translocator ABCB4 OS=Homo sapiens GN=ABCB4 PE=1 SV=2 1204 1446 6.0E-27
sp|Q4PH16|ATM1_USTMA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ATM1 PE=3 SV=1 1132 1438 6.0E-27
sp|Q4WLN7|ATM1_ASPFU Iron-sulfur clusters transporter atm1, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atm1 PE=3 SV=1 1217 1438 7.0E-27
sp|Q9QY30|ABCBB_MOUSE Bile salt export pump OS=Mus musculus GN=Abcb11 PE=1 SV=2 1210 1446 8.0E-27
sp|Q9LSJ5|AB18B_ARATH ABC transporter B family member 18 OS=Arabidopsis thaliana GN=ABCB18 PE=3 SV=1 1172 1438 9.0E-27
sp|Q96J65|MRP9_HUMAN Multidrug resistance-associated protein 9 OS=Homo sapiens GN=ABCC12 PE=1 SV=2 991 1456 1.0E-26
sp|P36619|PMD1_SCHPO Leptomycin B resistance protein pmd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmd1 PE=3 SV=2 944 1438 1.0E-26
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 1204 1446 1.0E-26
sp|Q2HIE9|ATM1_CHAGB Iron-sulfur clusters transporter ATM1, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATM1 PE=3 SV=1 1214 1438 1.0E-26
sp|Q8R4P9|MRP7_MOUSE Multidrug resistance-associated protein 7 OS=Mus musculus GN=Abcc10 PE=1 SV=1 181 833 2.0E-26
sp|Q9FWX7|AB11B_ARATH ABC transporter B family member 11 OS=Arabidopsis thaliana GN=ABCB11 PE=2 SV=1 1205 1450 2.0E-26
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 1216 1438 2.0E-26
sp|Q9LHD1|AB15B_ARATH ABC transporter B family member 15 OS=Arabidopsis thaliana GN=ABCB15 PE=3 SV=1 1217 1438 2.0E-26
sp|Q54BT3|ABCB2_DICDI ABC transporter B family member 2 OS=Dictyostelium discoideum GN=abcB2 PE=3 SV=1 1203 1420 3.0E-26
sp|P23174|MDR3_CRIGR Phosphatidylcholine translocator ABCB4 OS=Cricetulus griseus GN=ABCB4 PE=2 SV=1 1204 1446 3.0E-26
sp|Q8T9W1|TAGD_DICDI Serine protease/ABC transporter B family protein tagD OS=Dictyostelium discoideum GN=tagD PE=3 SV=1 1217 1446 3.0E-26
sp|Q03518|TAP1_HUMAN Antigen peptide transporter 1 OS=Homo sapiens GN=TAP1 PE=1 SV=2 979 1438 3.0E-26
sp|Q9SYI3|AB5B_ARATH ABC transporter B family member 5 OS=Arabidopsis thaliana GN=ABCB5 PE=3 SV=1 1216 1450 4.0E-26
sp|Q9QY30|ABCBB_MOUSE Bile salt export pump OS=Mus musculus GN=Abcb11 PE=1 SV=2 935 1438 4.0E-26
sp|Q9N0V3|ABCBB_RABIT Bile salt export pump OS=Oryctolagus cuniculus GN=ABCB11 PE=2 SV=1 1208 1438 4.0E-26
sp|P36497|PEDD_PEDAC Pediocin PA-1 transport/processing ATP-binding protein PedD OS=Pediococcus acidilactici GN=pedD PE=3 SV=1 987 1457 5.0E-26
sp|Q00PJ2|CFTR_ATEAB Cystic fibrosis transmembrane conductance regulator OS=Atelerix albiventris GN=CFTR PE=3 SV=1 629 824 7.0E-26
sp|Q2QLA3|CFTR_HORSE Cystic fibrosis transmembrane conductance regulator OS=Equus caballus GN=CFTR PE=3 SV=1 629 824 7.0E-26
sp|Q9GTN7|TAGA_DICDI Serine protease/ABC transporter B family protein tagA OS=Dictyostelium discoideum GN=tagA PE=1 SV=2 1217 1438 1.0E-25
sp|P26361|CFTR_MOUSE Cystic fibrosis transmembrane conductance regulator OS=Mus musculus GN=Cftr PE=1 SV=2 635 824 2.0E-25
sp|Q6YUU5|MDR_ORYSJ Putative multidrug resistance protein OS=Oryza sativa subsp. japonica GN=Os02g0190300 PE=3 SV=1 1201 1448 2.0E-25
sp|O70127|ABCBB_RAT Bile salt export pump OS=Rattus norvegicus GN=Abcb11 PE=1 SV=1 973 1438 2.0E-25
sp|P12866|STE6_YEAST Alpha-factor-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE6 PE=1 SV=1 1159 1455 2.0E-25
sp|O31707|YKNU_BACSU Uncharacterized ABC transporter ATP-binding protein YknU OS=Bacillus subtilis (strain 168) GN=yknU PE=3 SV=3 1217 1450 2.0E-25
sp|Q28433|TAP1_GORGO Antigen peptide transporter 1 OS=Gorilla gorilla gorilla GN=TAP1 PE=2 SV=2 979 1438 2.0E-25
sp|Q2IBE4|CFTR_PONAB Cystic fibrosis transmembrane conductance regulator OS=Pongo abelii GN=CFTR PE=3 SV=1 629 824 3.0E-25
sp|Q07DV2|CFTR_AOTNA Cystic fibrosis transmembrane conductance regulator OS=Aotus nancymaae GN=CFTR PE=3 SV=1 629 824 3.0E-25
sp|Q2QLF9|CFTR_CALJA Cystic fibrosis transmembrane conductance regulator OS=Callithrix jacchus GN=CFTR PE=3 SV=1 629 824 3.0E-25
sp|Q2QL83|CFTR_MICMU Cystic fibrosis transmembrane conductance regulator OS=Microcebus murinus GN=CFTR PE=3 SV=1 635 824 3.0E-25
sp|Q2QLB4|CFTR_CALMO Cystic fibrosis transmembrane conductance regulator OS=Callicebus moloch GN=CFTR PE=3 SV=1 629 824 3.0E-25
sp|Q07DX5|CFTR_NOMLE Cystic fibrosis transmembrane conductance regulator OS=Nomascus leucogenys GN=CFTR PE=3 SV=1 629 824 3.0E-25
sp|O53645|MDREP_MYCTU Multidrug efflux ATP-binding/permease protein Rv0194 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0194 PE=1 SV=1 1219 1437 3.0E-25
sp|Q0WML0|AB27B_ARATH ABC transporter B family member 27 OS=Arabidopsis thaliana GN=ABCB27 PE=1 SV=1 1210 1438 3.0E-25
sp|A1KF14|MDREP_MYCBP Multidrug efflux ATP-binding/permease protein BCG_0231 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_0231 PE=1 SV=1 1219 1437 3.0E-25
sp|Q2IBF6|CFTR_GORGO Cystic fibrosis transmembrane conductance regulator OS=Gorilla gorilla gorilla GN=CFTR PE=3 SV=1 629 824 4.0E-25
sp|Q07DZ6|CFTR_ORNAN Cystic fibrosis transmembrane conductance regulator OS=Ornithorhynchus anatinus GN=CFTR PE=3 SV=1 562 824 4.0E-25
sp|Q9VL32|SUR_DROME ATP-binding cassette sub-family C member Sur OS=Drosophila melanogaster GN=Sur PE=1 SV=4 646 832 4.0E-25
sp|Q2QLH0|CFTR_OTOGA Cystic fibrosis transmembrane conductance regulator OS=Otolemur garnettii GN=CFTR PE=3 SV=1 635 824 5.0E-25
sp|Q00748|MDR65_DROME Multidrug resistance protein homolog 65 OS=Drosophila melanogaster GN=Mdr65 PE=1 SV=2 927 1438 6.0E-25
sp|Q0P9C4|PGLK_CAMJE Protein glycosylation K OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pglK PE=1 SV=1 1198 1430 7.0E-25
sp|Q9FHF1|AB7B_ARATH ABC transporter B family member 7 OS=Arabidopsis thaliana GN=ABCB7 PE=3 SV=1 1204 1448 8.0E-25
sp|Q8LPK2|AB2B_ARATH ABC transporter B family member 2 OS=Arabidopsis thaliana GN=ABCB2 PE=1 SV=3 1216 1448 8.0E-25
sp|P45081|CYDC_HAEIN ATP-binding/permease protein CydC OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=cydC PE=3 SV=1 1219 1452 9.0E-25
sp|O53645|MDREP_MYCTU Multidrug efflux ATP-binding/permease protein Rv0194 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0194 PE=1 SV=1 1123 1438 2.0E-24
sp|A1KF14|MDREP_MYCBP Multidrug efflux ATP-binding/permease protein BCG_0231 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_0231 PE=1 SV=1 1123 1438 2.0E-24
sp|Q23868|TAGC_DICDI Serine protease/ABC transporter B family protein tagC OS=Dictyostelium discoideum GN=tagC PE=2 SV=2 1216 1455 2.0E-24
sp|Q89A97|MDLA_BUCBP Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mdlA PE=3 SV=1 1227 1455 2.0E-24
sp|O95342|ABCBB_HUMAN Bile salt export pump OS=Homo sapiens GN=ABCB11 PE=1 SV=2 873 1438 4.0E-24
sp|Q8LPQ6|AB28B_ARATH ABC transporter B family member 28 OS=Arabidopsis thaliana GN=ABCB28 PE=2 SV=1 1007 1438 6.0E-24
sp|P94367|CYDD_BACSU ATP-binding/permease protein CydD OS=Bacillus subtilis (strain 168) GN=cydD PE=3 SV=1 1215 1450 8.0E-24
sp|P12866|STE6_YEAST Alpha-factor-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE6 PE=1 SV=1 1219 1446 1.0E-23
sp|Q00748|MDR65_DROME Multidrug resistance protein homolog 65 OS=Drosophila melanogaster GN=Mdr65 PE=1 SV=2 1219 1438 1.0E-23
sp|Q9LHK4|AB8B_ARATH Putative ABC transporter B family member 8 OS=Arabidopsis thaliana GN=ABCB8 PE=5 SV=1 1155 1437 1.0E-23
sp|Q06034|MDR1_LEIEN Multidrug resistance protein 1 OS=Leishmania enriettii GN=MDR1 PE=3 SV=1 1219 1438 1.0E-23
sp|P34158|CFTR_RAT Cystic fibrosis transmembrane conductance regulator OS=Rattus norvegicus GN=Cftr PE=1 SV=3 635 824 4.0E-23
sp|Q8SQI5|ABC1_ENCCU Probable ABC transporter ECU01_0200/ECU01_1410 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU01_0200 PE=3 SV=1 1215 1454 4.0E-23
sp|P54683|TAGB_DICDI Serine protease/ABC transporter B family protein tagB OS=Dictyostelium discoideum GN=tagB PE=3 SV=2 1217 1450 6.0E-23
sp|Q5F364|MRP1_CHICK Multidrug resistance-associated protein 1 OS=Gallus gallus GN=ABCC1 PE=2 SV=1 871 1454 1.0E-22
sp|Q9LZB8|AB29B_ARATH ABC transporter B family member 29, chloroplastic OS=Arabidopsis thaliana GN=ABCB29 PE=2 SV=1 1009 1440 1.0E-22
sp|P33527|MRP1_HUMAN Multidrug resistance-associated protein 1 OS=Homo sapiens GN=ABCC1 PE=1 SV=3 1084 1448 2.0E-22
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum GN=abcC8 PE=3 SV=1 1035 1448 2.0E-22
sp|Q8K985|MDLA_BUCAP Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=mdlA PE=3 SV=1 1155 1457 2.0E-22
sp|Q92887|MRP2_HUMAN Canalicular multispecific organic anion transporter 1 OS=Homo sapiens GN=ABCC2 PE=1 SV=3 1064 1454 3.0E-22
sp|Q6UR05|MRP1_CANLF Multidrug resistance-associated protein 1 OS=Canis lupus familiaris GN=ABCC1 PE=2 SV=1 1084 1448 3.0E-22
sp|Q9M3B9|AB20B_ARATH ABC transporter B family member 20 OS=Arabidopsis thaliana GN=ABCB20 PE=1 SV=1 974 1438 3.0E-22
sp|Q1WSB8|ECFA1_LACS1 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus salivarius (strain UCC118) GN=ecfA1 PE=3 SV=1 1219 1442 3.0E-22
sp|Q04EY5|ECFA1_OENOB Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=ecfA1 PE=3 SV=1 1219 1442 4.0E-22
sp|O35379|MRP1_MOUSE Multidrug resistance-associated protein 1 OS=Mus musculus GN=Abcc1 PE=1 SV=1 851 1454 5.0E-22
sp|Q9ZNB0|Y742_STRCO Uncharacterized ABC transporter ATP-binding protein SCO0742 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO0742 PE=3 SV=1 1062 1448 6.0E-22
sp|Q02ME3|METN1_PSEAB Methionine import ATP-binding protein MetN 1 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=metN1 PE=3 SV=1 1208 1433 7.0E-22
sp|Q9EXN5|MCHF_ECOLX Probable microcin-H47 secretion/processing ATP-binding protein MchF OS=Escherichia coli GN=mchF PE=3 SV=1 979 1421 8.0E-22
sp|Q88RB3|METN2_PSEPK Methionine import ATP-binding protein MetN 2 OS=Pseudomonas putida (strain KT2440) GN=metN2 PE=3 SV=1 1216 1433 9.0E-22
sp|Q864R9|MRP1_MACFA Multidrug resistance-associated protein 1 OS=Macaca fascicularis GN=ABCC1 PE=2 SV=1 1084 1448 1.0E-21
sp|O88563|MRP3_RAT Canalicular multispecific organic anion transporter 2 OS=Rattus norvegicus GN=Abcc3 PE=1 SV=1 1084 1454 1.0E-21
sp|P10346|GLNQ_ECOLI Glutamine transport ATP-binding protein GlnQ OS=Escherichia coli (strain K12) GN=glnQ PE=1 SV=1 1219 1443 1.0E-21
sp|Q8CG09|MRP1_RAT Multidrug resistance-associated protein 1 OS=Rattus norvegicus GN=Abcc1 PE=1 SV=2 1084 1454 2.0E-21
sp|Q9LHK4|AB8B_ARATH Putative ABC transporter B family member 8 OS=Arabidopsis thaliana GN=ABCB8 PE=5 SV=1 1169 1454 2.0E-21
sp|Q06034|MDR1_LEIEN Multidrug resistance protein 1 OS=Leishmania enriettii GN=MDR1 PE=3 SV=1 1178 1438 2.0E-21
sp|Q8DZJ0|POTA_STRA5 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=potA PE=3 SV=1 1219 1437 2.0E-21
sp|Q8E554|POTA_STRA3 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus agalactiae serotype III (strain NEM316) GN=potA PE=3 SV=1 1219 1437 2.0E-21
sp|Q3K0Y6|POTA_STRA1 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=potA PE=3 SV=1 1219 1437 2.0E-21
sp|P77265|MDLA_ECOLI Multidrug resistance-like ATP-binding protein MdlA OS=Escherichia coli (strain K12) GN=mdlA PE=3 SV=1 599 838 3.0E-21
sp|P45171|POTA_HAEIN Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=potA PE=3 SV=2 1219 1445 3.0E-21
sp|Q4QK57|POTA_HAEI8 Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus influenzae (strain 86-028NP) GN=potA PE=3 SV=2 1219 1445 3.0E-21
sp|Q1IGN4|METN1_PSEE4 Methionine import ATP-binding protein MetN 1 OS=Pseudomonas entomophila (strain L48) GN=metN1 PE=3 SV=1 1216 1433 4.0E-21
sp|B2RX12|MRP3_MOUSE Canalicular multispecific organic anion transporter 2 OS=Mus musculus GN=Abcc3 PE=1 SV=1 1065 1454 6.0E-21
sp|Q8T9W4|ABCB3_DICDI ABC transporter B family member 3 OS=Dictyostelium discoideum GN=abcB3 PE=3 SV=1 1217 1439 6.0E-21
sp|Q8LPT1|AB6B_ARATH ABC transporter B family member 6 OS=Arabidopsis thaliana GN=ABCB6 PE=1 SV=2 974 1438 6.0E-21
sp|Q9I1C8|METN1_PSEAE Methionine import ATP-binding protein MetN 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=metN1 PE=3 SV=1 1208 1433 6.0E-21
sp|O85818|POTA_AGGAC Spermidine/putrescine import ATP-binding protein PotA OS=Aggregatibacter actinomycetemcomitans GN=potA PE=3 SV=1 1219 1445 7.0E-21
sp|P78966|MAM1_SCHPO Mating factor M secretion protein mam1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mam1 PE=3 SV=1 1221 1456 9.0E-21
sp|Q38UT9|ECFA1_LACSS Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=ecfA1 PE=3 SV=1 1228 1438 1.0E-20
sp|Q87UV4|METN1_PSESM Methionine import ATP-binding protein MetN 1 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=metN1 PE=3 SV=2 1194 1432 1.0E-20
sp|Q8DPC2|POTA_STRR6 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=potA PE=3 SV=1 1219 1437 2.0E-20
sp|Q97Q42|POTA_STRPN Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=potA PE=3 SV=1 1219 1437 2.0E-20
sp|Q04JW0|POTA_STRP2 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=potA PE=3 SV=1 1219 1437 2.0E-20
sp|A3CMQ7|POTA_STRSV Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus sanguinis (strain SK36) GN=potA PE=3 SV=1 1219 1437 2.0E-20
sp|P57551|MDLA_BUCAI Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mdlA PE=3 SV=1 1155 1457 2.0E-20
sp|Q4A5A5|ECFA1_MYCS5 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma synoviae (strain 53) GN=ecfA1 PE=3 SV=1 1219 1438 2.0E-20
sp|P22520|CVAB_ECOLX Colicin V secretion/processing ATP-binding protein CvaB OS=Escherichia coli GN=cvaB PE=3 SV=1 979 1421 2.0E-20
sp|Q8TI16|ECFA_METAC Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=ecfA PE=3 SV=1 1219 1455 2.0E-20
sp|Q8HXQ5|MRP1_BOVIN Multidrug resistance-associated protein 1 OS=Bos taurus GN=ABCC1 PE=2 SV=1 854 1448 3.0E-20
sp|Q6F1W5|ECFA1_MESFL Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=ecfA1 PE=3 SV=1 1219 1439 3.0E-20
sp|Q4ZZK0|METN2_PSEU2 Methionine import ATP-binding protein MetN 2 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=metN2 PE=3 SV=1 1218 1432 3.0E-20
sp|Q65P77|ECFA1_BACLD Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=ecfA1 PE=3 SV=1 1215 1439 4.0E-20
sp|Q7CN92|POTA_STRP8 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=potA PE=3 SV=1 1219 1437 5.0E-20
sp|Q99ZS8|POTA_STRP1 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M1 GN=potA PE=3 SV=1 1219 1437 5.0E-20
sp|A0PXX8|ECFA2_CLONN Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium novyi (strain NT) GN=ecfA2 PE=3 SV=1 1219 1442 5.0E-20
sp|P0CZ35|POTA_STRPQ Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=potA PE=3 SV=1 1219 1437 5.0E-20
sp|Q48TP4|POTA_STRPM Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=potA PE=3 SV=1 1219 1437 5.0E-20
sp|P0CZ34|POTA_STRP3 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=potA PE=3 SV=1 1219 1437 5.0E-20
sp|P45769|YHDZ_ECOLI Uncharacterized amino-acid ABC transporter ATP-binding protein YhdZ OS=Escherichia coli (strain K12) GN=yhdZ PE=3 SV=1 1214 1438 5.0E-20
sp|Q5XCA4|POTA_STRP6 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=potA PE=3 SV=1 1219 1437 5.0E-20
sp|P53706|HST6_CANAW Alpha-factor-transporting ATPase OS=Candida albicans (strain WO-1) GN=HST6 PE=3 SV=1 1217 1437 6.0E-20
sp|Q1J6Q6|POTA_STRPF Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=potA PE=3 SV=1 1219 1437 7.0E-20
sp|Q1JGY7|POTA_STRPD Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=potA PE=3 SV=1 1219 1437 7.0E-20
sp|Q1JLT7|POTA_STRPC Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=potA PE=3 SV=1 1219 1437 7.0E-20
sp|Q1JBV6|POTA_STRPB Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=potA PE=3 SV=1 1219 1437 7.0E-20
sp|Q4KK46|METN2_PSEF5 Methionine import ATP-binding protein MetN 2 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=metN2 PE=3 SV=1 1222 1457 8.0E-20
sp|Q7A7E3|METN1_STAAN Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain N315) GN=metN1 PE=3 SV=1 1219 1438 9.0E-20
sp|O15438|MRP3_HUMAN Canalicular multispecific organic anion transporter 2 OS=Homo sapiens GN=ABCC3 PE=1 SV=3 1015 1443 1.0E-19
sp|Q00564|LCNC_LACLL Lactococcin-A transport/processing ATP-binding protein LcnC OS=Lactococcus lactis subsp. lactis GN=lcnC PE=3 SV=1 624 843 1.0E-19
sp|Q9CJB8|LCNCL_LACLA Lactococcin transport/processing ATP-binding protein LcnC-like OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lcnC PE=3 SV=1 624 843 3.0E-19
sp|Q8P8W4|MSBA_XANCP Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=msbA PE=3 SV=1 536 837 1.0E-18
sp|Q4UV65|MSBA_XANC8 Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. campestris (strain 8004) GN=msbA PE=3 SV=1 536 837 1.0E-18
sp|Q5H0H0|MSBA_XANOR Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=msbA PE=3 SV=1 625 846 2.0E-18
sp|Q2P3E7|MSBA_XANOM Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=msbA PE=3 SV=1 625 846 2.0E-18
sp|P78966|MAM1_SCHPO Mating factor M secretion protein mam1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mam1 PE=3 SV=1 1212 1438 2.0E-18
sp|Q9N0V3|ABCBB_RABIT Bile salt export pump OS=Oryctolagus cuniculus GN=ABCB11 PE=2 SV=1 1216 1438 3.0E-18
sp|Q89A97|MDLA_BUCBP Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mdlA PE=3 SV=1 630 833 3.0E-18
sp|Q8LPT1|AB6B_ARATH ABC transporter B family member 6 OS=Arabidopsis thaliana GN=ABCB6 PE=1 SV=2 1217 1432 3.0E-18
sp|P54718|YFIB_BACSU Uncharacterized ABC transporter ATP-binding protein YfiB OS=Bacillus subtilis (strain 168) GN=yfiB PE=3 SV=1 628 837 5.0E-18
sp|O07550|YHEI_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheI OS=Bacillus subtilis (strain 168) GN=yheI PE=1 SV=1 623 843 6.0E-18
sp|Q8K985|MDLA_BUCAP Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=mdlA PE=3 SV=1 631 855 7.0E-18
sp|Q3BTC8|MSBA_XANC5 Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=msbA PE=3 SV=1 625 846 8.0E-18
sp|Q8PKS5|MSBA_XANAC Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=msbA PE=3 SV=1 625 846 1.0E-17
sp|P36497|PEDD_PEDAC Pediocin PA-1 transport/processing ATP-binding protein PedD OS=Pediococcus acidilactici GN=pedD PE=3 SV=1 624 832 4.0E-17
sp|Q9ZCM8|Y696_RICPR Putative export ATP-binding/permease protein RP696 OS=Rickettsia prowazekii (strain Madrid E) GN=RP696 PE=3 SV=1 617 835 5.0E-17
sp|Q9M3B9|AB20B_ARATH ABC transporter B family member 20 OS=Arabidopsis thaliana GN=ABCB20 PE=1 SV=1 1217 1437 5.0E-17
sp|Q5A762|MLT1_CANAL Multiple drug resistance-associated protein-like transporter 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MLT1 PE=1 SV=1 1155 1439 8.0E-17
sp|Q8T9W2|ABCB5_DICDI ABC transporter B family member 5 OS=Dictyostelium discoideum GN=abcB5 PE=3 SV=1 601 837 8.0E-17
sp|Q9VL32|SUR_DROME ATP-binding cassette sub-family C member Sur OS=Drosophila melanogaster GN=Sur PE=1 SV=4 889 1140 1.0E-16
sp|Q6AJW3|MSBA_DESPS Lipid A export ATP-binding/permease protein MsbA OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=msbA PE=3 SV=1 498 837 1.0E-16
sp|Q2G2M9|Y2003_STAA8 Putative multidrug export ATP-binding/permease protein SAOUHSC_02003 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02003 PE=3 SV=1 483 843 1.0E-16
sp|Q6GFJ1|Y1956_STAAR Putative multidrug export ATP-binding/permease protein SAR1956 OS=Staphylococcus aureus (strain MRSA252) GN=SAR1956 PE=3 SV=1 483 843 1.0E-16
sp|Q5HEQ8|Y1924_STAAC Putative multidrug export ATP-binding/permease protein SACOL1924 OS=Staphylococcus aureus (strain COL) GN=SACOL1924 PE=3 SV=1 483 843 1.0E-16
sp|Q99T13|Y1866_STAAM Putative multidrug export ATP-binding/permease protein SAV1866 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV1866 PE=1 SV=1 483 843 1.0E-16
sp|Q2FFM9|Y1847_STAA3 Putative multidrug export ATP-binding/permease protein SAUSA300_1847 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_1847 PE=3 SV=1 483 843 1.0E-16
sp|Q7A0J1|Y1806_STAAW Putative multidrug export ATP-binding/permease protein MW1806 OS=Staphylococcus aureus (strain MW2) GN=MW1806 PE=3 SV=1 483 843 1.0E-16
sp|Q6G868|Y1788_STAAS Putative multidrug export ATP-binding/permease protein SAS1788 OS=Staphylococcus aureus (strain MSSA476) GN=SAS1788 PE=3 SV=1 483 843 1.0E-16
sp|Q7A4T3|Y1683_STAAN Putative multidrug export ATP-binding/permease protein SA1683 OS=Staphylococcus aureus (strain N315) GN=SA1683 PE=1 SV=1 483 843 1.0E-16
sp|Q68W42|Y691_RICTY Putative export ATP-binding/permease protein RT0691 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=RT0691 PE=3 SV=1 637 838 1.0E-16
sp|Q92GP9|Y1073_RICCN Putative export ATP-binding/permease protein RC1073 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=RC1073 PE=3 SV=1 628 838 2.0E-16
sp|Q54VC1|ABCCF_DICDI ABC transporter C family member 15 OS=Dictyostelium discoideum GN=abcC15 PE=3 SV=1 637 824 3.0E-16
sp|Q0P9C4|PGLK_CAMJE Protein glycosylation K OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pglK PE=1 SV=1 631 831 3.0E-16
sp|P59852|LAGD_LACLL Lactococcin-G-processing and transport ATP-binding protein LagD OS=Lactococcus lactis subsp. lactis GN=lagD PE=1 SV=1 637 838 4.0E-16
sp|Q4UMZ3|Y214_RICFE Putative export ATP-binding/permease protein RF_0214 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0214 PE=3 SV=2 638 838 4.0E-16
sp|Q54EK2|ABCC7_DICDI ABC transporter C family member 7 OS=Dictyostelium discoideum GN=abcC7 PE=3 SV=1 1084 1437 6.0E-16
sp|Q9LSJ2|AB22B_ARATH ABC transporter B family member 22 OS=Arabidopsis thaliana GN=ABCB22 PE=3 SV=2 388 855 8.0E-16
sp|Q2YU20|Y1799_STAAB Putative multidrug export ATP-binding/permease protein SAB1799c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB1799c PE=3 SV=1 483 843 9.0E-16
sp|Q21NS8|MSBA_SACD2 Lipid A export ATP-binding/permease protein MsbA OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=msbA PE=3 SV=1 624 842 1.0E-15
sp|Q10418|MESD_LEUME Mesentericin-Y105 transport/processing ATP-binding protein MesD OS=Leuconostoc mesenteroides GN=mesD PE=3 SV=1 635 837 1.0E-15
sp|P94367|CYDD_BACSU ATP-binding/permease protein CydD OS=Bacillus subtilis (strain 168) GN=cydD PE=3 SV=1 612 842 1.0E-15
sp|Q9Y7M7|MDL1_SCHPO ATP-dependent permease MDL1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdl1 PE=3 SV=1 638 838 2.0E-15
sp|Q5QU36|MSBA_IDILO Lipid A export ATP-binding/permease protein MsbA OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=msbA PE=3 SV=1 623 837 3.0E-15
sp|Q1RJ91|Y492_RICBR Putative export ATP-binding/permease protein RBE_0492 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0492 PE=3 SV=1 637 832 4.0E-15
sp|Q7VWD8|MSBA_BORPE Lipid A export ATP-binding/permease protein MsbA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=msbA PE=3 SV=1 520 844 6.0E-15
sp|Q7W9N7|MSBA_BORPA Lipid A export ATP-binding/permease protein MsbA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=msbA PE=3 SV=1 520 844 6.0E-15
sp|Q7WH20|MSBA_BORBR Lipid A export ATP-binding/permease protein MsbA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=msbA PE=3 SV=2 520 844 6.0E-15
sp|Q9LSJ2|AB22B_ARATH ABC transporter B family member 22 OS=Arabidopsis thaliana GN=ABCB22 PE=3 SV=2 638 832 6.0E-15
sp|Q54BU4|ABCB1_DICDI ABC transporter B family member 1 OS=Dictyostelium discoideum GN=abcB1 PE=3 SV=1 635 844 7.0E-15
sp|P22638|HEPA_NOSS1 Heterocyst differentiation ATP-binding protein HepA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hepA PE=2 SV=3 638 837 9.0E-15
sp|Q9PEE7|MSBA_XYLFA Lipid A export ATP-binding/permease protein MsbA OS=Xylella fastidiosa (strain 9a5c) GN=msbA PE=3 SV=1 628 832 1.0E-14
sp|Q8DAV2|MSBA_VIBVU Lipid A export ATP-binding/permease protein MsbA OS=Vibrio vulnificus (strain CMCP6) GN=msbA PE=3 SV=1 624 837 1.0E-14
sp|Q21WN9|MSBA_RHOFT Lipid A export ATP-binding/permease protein MsbA OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=msbA PE=3 SV=1 625 832 1.0E-14
sp|Q9NP78|ABCB9_HUMAN ATP-binding cassette sub-family B member 9 OS=Homo sapiens GN=ABCB9 PE=1 SV=1 602 869 1.0E-14
sp|Q9CMG7|MSBA_PASMU Lipid A export ATP-binding/permease protein MsbA OS=Pasteurella multocida (strain Pm70) GN=msbA PE=3 SV=1 631 843 1.0E-14
sp|Q9LHD1|AB15B_ARATH ABC transporter B family member 15 OS=Arabidopsis thaliana GN=ABCB15 PE=3 SV=1 611 832 1.0E-14
sp|Q87EF0|MSBA_XYLFT Lipid A export ATP-binding/permease protein MsbA OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=msbA PE=3 SV=1 628 832 2.0E-14
sp|Q1MAB5|NDVA_RHIL3 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ndvA PE=3 SV=1 639 843 2.0E-14
sp|Q87R16|MSBA_VIBPA Lipid A export ATP-binding/permease protein MsbA OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=msbA PE=3 SV=1 624 843 2.0E-14
sp|Q46Y89|MSBA_CUPPJ Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=msbA PE=3 SV=1 630 844 2.0E-14
sp|O31707|YKNU_BACSU Uncharacterized ABC transporter ATP-binding protein YknU OS=Bacillus subtilis (strain 168) GN=yknU PE=3 SV=3 604 837 2.0E-14
sp|Q7MJ07|MSBA_VIBVY Lipid A export ATP-binding/permease protein MsbA OS=Vibrio vulnificus (strain YJ016) GN=msbA PE=3 SV=2 624 837 3.0E-14
sp|P36372|TAP2_RAT Antigen peptide transporter 2 OS=Rattus norvegicus GN=Tap2 PE=2 SV=1 625 846 3.0E-14
sp|Q59R09|ATM1_CANAL Iron-sulfur clusters transporter ATM1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATM1 PE=3 SV=1 637 832 3.0E-14
sp|P71082|YGAD_BACSU Putative multidrug export ATP-binding/permease protein YgaD OS=Bacillus subtilis (strain 168) GN=ygaD PE=3 SV=2 611 837 3.0E-14
sp|Q9ZR72|AB1B_ARATH ABC transporter B family member 1 OS=Arabidopsis thaliana GN=ABCB1 PE=1 SV=1 638 837 3.0E-14
sp|O06967|BMRA_BACSU Multidrug resistance ABC transporter ATP-binding/permease protein BmrA OS=Bacillus subtilis (strain 168) GN=bmrA PE=1 SV=1 638 844 3.0E-14
sp|Q92337|ABC1_SCHPO ATP-binding cassette transporter abc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc1 PE=3 SV=1 1084 1457 4.0E-14
sp|O07549|YHEH_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheH OS=Bacillus subtilis (strain 168) GN=yheH PE=1 SV=1 476 837 4.0E-14
sp|P18767|NDVA_RHIME Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium meliloti (strain 1021) GN=ndvA PE=1 SV=2 626 843 4.0E-14
sp|P45081|CYDC_HAEIN ATP-binding/permease protein CydC OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=cydC PE=3 SV=1 631 843 4.0E-14
sp|P57551|MDLA_BUCAI Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mdlA PE=3 SV=1 624 847 4.0E-14
sp|Q2K342|NDVA_RHIEC Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ndvA PE=3 SV=2 639 843 5.0E-14
sp|Q6BXD7|ATM1_DEBHA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATM1 PE=3 SV=2 602 877 6.0E-14
sp|Q08201|MDR3_RAT Phosphatidylcholine translocator ABCB4 OS=Rattus norvegicus GN=Abcb4 PE=1 SV=1 610 844 6.0E-14
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 610 844 6.0E-14
sp|Q9NP58|ABCB6_HUMAN ATP-binding cassette sub-family B member 6, mitochondrial OS=Homo sapiens GN=ABCB6 PE=1 SV=1 599 837 7.0E-14
sp|P0CL93|ATM1_CRYNB Iron-sulfur clusters transporter ATM1, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATM1 PE=3 SV=1 604 881 7.0E-14
sp|P36371|TAP2_MOUSE Antigen peptide transporter 2 OS=Mus musculus GN=Tap2 PE=1 SV=1 625 846 8.0E-14
sp|P33311|MDL2_YEAST ATP-dependent permease MDL2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDL2 PE=1 SV=3 638 882 8.0E-14
sp|Q9DC29|ABCB6_MOUSE ATP-binding cassette sub-family B member 6, mitochondrial OS=Mus musculus GN=Abcb6 PE=1 SV=1 599 859 9.0E-14
sp|Q9LSJ6|AB17B_ARATH ABC transporter B family member 17 OS=Arabidopsis thaliana GN=ABCB17 PE=3 SV=1 638 832 9.0E-14
sp|P26362|CFTR_SQUAC Cystic fibrosis transmembrane conductance regulator OS=Squalus acanthias GN=CFTR PE=1 SV=1 1235 1437 1.0E-13
sp|Q1BUV6|MSBA_BURCA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia cenocepacia (strain AU 1054) GN=msbA PE=3 SV=2 628 837 1.0E-13
sp|Q8XXB6|MSBA_RALSO Lipid A export ATP-binding/permease protein MsbA OS=Ralstonia solanacearum (strain GMI1000) GN=msbA PE=3 SV=1 630 832 1.0E-13
sp|O75027|ABCB7_HUMAN ATP-binding cassette sub-family B member 7, mitochondrial OS=Homo sapiens GN=ABCB7 PE=1 SV=2 602 832 1.0E-13
sp|P0CL92|ATM1_CRYNJ Iron-sulfur clusters transporter ATM1, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATM1 PE=3 SV=1 604 881 1.0E-13
sp|Q71ED1|NDVA_AGRVI Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Agrobacterium vitis GN=ndvA PE=3 SV=1 639 838 2.0E-13
sp|Q2SIN5|MSBA_HAHCH Lipid A export ATP-binding/permease protein MsbA OS=Hahella chejuensis (strain KCTC 2396) GN=msbA PE=3 SV=1 593 832 2.0E-13
sp|P97998|MDL1_CANAX ATP-dependent permease MDL1 OS=Candida albicans GN=MDL1 PE=3 SV=1 600 837 2.0E-13
sp|Q39E73|MSBA_BURL3 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=msbA PE=3 SV=2 631 837 2.0E-13
sp|Q9JJ59|ABCB9_MOUSE ATP-binding cassette sub-family B member 9 OS=Mus musculus GN=Abcb9 PE=2 SV=1 602 869 2.0E-13
sp|Q983H5|NDVA_RHILO Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium loti (strain MAFF303099) GN=ndvA PE=3 SV=1 609 839 2.0E-13
sp|P33310|MDL1_YEAST ATP-dependent permease MDL1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDL1 PE=1 SV=2 602 882 2.0E-13
sp|Q9LSJ8|AB16B_ARATH ABC transporter B family member 16 OS=Arabidopsis thaliana GN=ABCB16 PE=2 SV=1 638 832 2.0E-13
sp|Q9LZB8|AB29B_ARATH ABC transporter B family member 29, chloroplastic OS=Arabidopsis thaliana GN=ABCB29 PE=2 SV=1 588 849 2.0E-13
sp|Q2KYS6|MSBA_BORA1 Lipid A export ATP-binding/permease protein MsbA OS=Bordetella avium (strain 197N) GN=msbA PE=3 SV=1 520 844 3.0E-13
sp|Q3J7R8|MSBA_NITOC Lipid A export ATP-binding/permease protein MsbA OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=msbA PE=3 SV=1 631 837 3.0E-13
sp|P55469|Y4GM_RHISN Uncharacterized ABC transporter ATP-binding protein y4gM OS=Rhizobium sp. (strain NGR234) GN=NGR_a03510 PE=3 SV=1 633 844 4.0E-13
sp|Q63VX7|MSBA_BURPS Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain K96243) GN=msbA PE=3 SV=1 632 832 4.0E-13
sp|Q3JUI6|MSBA_BURP1 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain 1710b) GN=msbA PE=3 SV=2 632 832 4.0E-13
sp|Q62IG3|MSBA_BURMA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia mallei (strain ATCC 23344) GN=msbA PE=3 SV=2 632 832 4.0E-13
sp|Q9QYJ4|ABCB9_RAT ATP-binding cassette sub-family B member 9 OS=Rattus norvegicus GN=Abcb9 PE=1 SV=1 638 837 4.0E-13
sp|Q02592|HMT1_SCHPO Heavy metal tolerance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hmt1 PE=2 SV=3 589 837 4.0E-13
sp|P14772|BPT1_YEAST Bile pigment transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BPT1 PE=1 SV=2 1056 1457 5.0E-13
sp|Q933I3|LKTB_MANGL Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia glucosida GN=lktB PE=3 SV=1 630 850 5.0E-13
sp|Q704E8|ABCB7_RAT ATP-binding cassette sub-family B member 7, mitochondrial OS=Rattus norvegicus GN=Abcb7 PE=1 SV=1 602 832 5.0E-13
sp|P23886|CYDC_ECOLI ATP-binding/permease protein CydC OS=Escherichia coli (strain K12) GN=cydC PE=3 SV=2 602 832 5.0E-13
sp|P34712|PGP1_CAEEL Multidrug resistance protein pgp-1 OS=Caenorhabditis elegans GN=pgp-1 PE=1 SV=2 631 854 6.0E-13
sp|Q1LQD3|MSBA_CUPMC Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=msbA PE=3 SV=1 623 844 6.0E-13
sp|Q61102|ABCB7_MOUSE ATP-binding cassette sub-family B member 7, mitochondrial OS=Mus musculus GN=Abcb7 PE=1 SV=3 602 832 6.0E-13
sp|Q9C7F8|AB13B_ARATH ABC transporter B family member 13 OS=Arabidopsis thaliana GN=ABCB13 PE=3 SV=1 638 843 6.0E-13
sp|Q9LVM1|AB25B_ARATH ABC transporter B family member 25, mitochondrial OS=Arabidopsis thaliana GN=ABCB25 PE=1 SV=1 599 837 6.0E-13
sp|P23174|MDR3_CRIGR Phosphatidylcholine translocator ABCB4 OS=Cricetulus griseus GN=ABCB4 PE=2 SV=1 610 844 6.0E-13
sp|Q2SZW0|MSBA_BURTA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=msbA PE=3 SV=1 632 832 8.0E-13
sp|Q2LVL0|MSBA_SYNAS Lipid A export ATP-binding/permease protein MsbA OS=Syntrophus aciditrophicus (strain SB) GN=msbA PE=3 SV=1 494 837 9.0E-13
sp|Q9LHK4|AB8B_ARATH Putative ABC transporter B family member 8 OS=Arabidopsis thaliana GN=ABCB8 PE=5 SV=1 638 837 9.0E-13
sp|P0C086|LKTB7_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 630 850 1.0E-12
sp|P0C087|LKB14_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 630 850 1.0E-12
sp|Q93FH0|LKB2A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=2 630 850 1.0E-12
sp|Q933E0|LKTB_BIBTR Leukotoxin translocation ATP-binding protein LktB OS=Bibersteinia trehalosi GN=lktB PE=3 SV=1 630 850 1.0E-12
sp|Q93FH6|LKB1B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 630 850 1.0E-12
sp|P16532|LKB1A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 630 850 1.0E-12
sp|Q93FH2|LKB13_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 630 850 1.0E-12
sp|Q93FH3|LKB16_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 630 850 1.0E-12
sp|Q93FG6|LKB2B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 630 850 1.0E-12
sp|P55122|LKTB_PASSP Leukotoxin translocation ATP-binding protein LktB OS=Pasteurella haemolytica-like sp. (strain 5943B) GN=lktB PE=3 SV=1 630 850 1.0E-12
sp|P59653|COMA_STRR6 Transport/processing ATP-binding protein ComA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=comA PE=3 SV=1 635 832 1.0E-12
sp|O31708|YKNV_BACSU Uncharacterized ABC transporter ATP-binding protein YknV OS=Bacillus subtilis (strain 168) GN=yknV PE=3 SV=1 599 844 1.0E-12
sp|P9WQJ7|IRTB_MYCTU Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtB PE=1 SV=1 615 842 1.0E-12
sp|P9WQJ6|IRTB_MYCTO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtB PE=3 SV=1 615 842 1.0E-12
sp|P63394|IRTB_MYCBO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtB PE=3 SV=1 615 842 1.0E-12
sp|Q5B1Q2|ATM1_EMENI Iron-sulfur clusters transporter atm1, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atm1 PE=3 SV=2 599 832 1.0E-12
sp|Q480N3|MSBA2_COLP3 Lipid A export ATP-binding/permease protein MsbA 2 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=msbA2 PE=3 SV=2 625 847 1.0E-12
sp|Q9LSJ8|AB16B_ARATH ABC transporter B family member 16 OS=Arabidopsis thaliana GN=ABCB16 PE=2 SV=1 598 837 1.0E-12
sp|Q5T3U5|MRP7_HUMAN Multidrug resistance-associated protein 7 OS=Homo sapiens GN=ABCC10 PE=1 SV=1 1241 1438 2.0E-12
sp|Q9KQW9|MSBA_VIBCH Lipid A export ATP-binding/permease protein MsbA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=msbA PE=1 SV=1 588 832 2.0E-12
sp|Q89A96|MDLB_BUCBP Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mdlB PE=3 SV=1 624 832 2.0E-12
sp|Q3SP57|NDVA_NITWN Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=ndvA PE=3 SV=2 598 843 2.0E-12
sp|Q8EDF0|MSBA_SHEON Lipid A export ATP-binding/permease protein MsbA OS=Shewanella oneidensis (strain MR-1) GN=msbA PE=3 SV=1 625 832 2.0E-12
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 637 844 2.0E-12
sp|Q00449|MDR49_DROME Multidrug resistance protein homolog 49 OS=Drosophila melanogaster GN=Mdr49 PE=2 SV=2 638 837 2.0E-12
sp|Q6C6N0|ATM1_YARLI Iron-sulfur clusters transporter ATM1, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATM1 PE=3 SV=1 637 832 2.0E-12
sp|Q28433|TAP1_GORGO Antigen peptide transporter 1 OS=Gorilla gorilla gorilla GN=TAP1 PE=2 SV=2 551 837 2.0E-12
sp|A7KVC2|AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays GN=MRP4 PE=2 SV=1 984 1452 3.0E-12
sp|P34158|CFTR_RAT Cystic fibrosis transmembrane conductance regulator OS=Rattus norvegicus GN=Cftr PE=1 SV=3 830 1437 3.0E-12
sp|Q65U21|MSBA_MANSM Lipid A export ATP-binding/permease protein MsbA OS=Mannheimia succiniciproducens (strain MBEL55E) GN=msbA PE=3 SV=2 588 843 3.0E-12
sp|Q0I4C5|MSBA_HAES1 Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus somnus (strain 129Pt) GN=msbA PE=3 SV=1 597 843 3.0E-12
sp|Q9LSJ5|AB18B_ARATH ABC transporter B family member 18 OS=Arabidopsis thaliana GN=ABCB18 PE=3 SV=1 638 832 3.0E-12
sp|P21439|MDR3_HUMAN Phosphatidylcholine translocator ABCB4 OS=Homo sapiens GN=ABCB4 PE=1 SV=2 637 844 3.0E-12
sp|Q07DZ6|CFTR_ORNAN Cystic fibrosis transmembrane conductance regulator OS=Ornithorhynchus anatinus GN=CFTR PE=3 SV=1 1216 1437 4.0E-12
sp|P26363|CFTR_XENLA Cystic fibrosis transmembrane conductance regulator OS=Xenopus laevis GN=cftr PE=2 SV=1 1198 1437 4.0E-12
sp|Q03727|COMA_STRPN Transport/processing ATP-binding protein ComA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=comA PE=3 SV=3 635 832 4.0E-12
sp|P21958|TAP1_MOUSE Antigen peptide transporter 1 OS=Mus musculus GN=Tap1 PE=1 SV=3 551 832 4.0E-12
sp|Q89UT8|NDVA_BRADU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ndvA PE=3 SV=1 595 857 4.0E-12
sp|Q54RU1|ABCB6_DICDI ABC transporter B family member 6 OS=Dictyostelium discoideum GN=abcB6 PE=3 SV=1 615 832 4.0E-12
sp|Q4WLN7|ATM1_ASPFU Iron-sulfur clusters transporter atm1, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atm1 PE=3 SV=1 599 844 4.0E-12
sp|Q12M46|MSBA_SHEDO Lipid A export ATP-binding/permease protein MsbA OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=msbA PE=3 SV=1 625 832 5.0E-12
sp|Q1QX69|MSBA_CHRSD Lipid A export ATP-binding/permease protein MsbA OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=msbA PE=3 SV=1 630 843 5.0E-12
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 637 844 5.0E-12
sp|Q0HTS8|MSBA_SHESR Lipid A export ATP-binding/permease protein MsbA OS=Shewanella sp. (strain MR-7) GN=msbA PE=3 SV=1 625 832 5.0E-12
sp|Q0HHH4|MSBA_SHESM Lipid A export ATP-binding/permease protein MsbA OS=Shewanella sp. (strain MR-4) GN=msbA PE=3 SV=1 625 832 5.0E-12
sp|Q31FG2|MSBA_THICR Lipid A export ATP-binding/permease protein MsbA OS=Thiomicrospira crunogena (strain XCL-2) GN=msbA PE=3 SV=1 625 846 6.0E-12
sp|Q5E0F2|MSBA_VIBF1 Lipid A export ATP-binding/permease protein MsbA OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=msbA PE=3 SV=1 605 843 6.0E-12
sp|Q8R4P9|MRP7_MOUSE Multidrug resistance-associated protein 7 OS=Mus musculus GN=Abcc10 PE=1 SV=1 1241 1438 7.0E-12
sp|Q142P6|MSBA_BURXL Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia xenovorans (strain LB400) GN=msbA PE=3 SV=1 639 832 7.0E-12
sp|P0A2V1|NDVA_RHIRD Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium radiobacter GN=ndvA PE=1 SV=1 639 838 8.0E-12
sp|P0A2V0|NDVA_AGRFC Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ndvA PE=3 SV=1 639 838 8.0E-12
sp|Q2ULH4|ATM1_ASPOR Iron-sulfur clusters transporter atm1, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atm1 PE=3 SV=1 599 832 8.0E-12
sp|P0A4W5|Y1304_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb1304c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1304c PE=3 SV=1 611 837 8.0E-12
sp|P9WQJ1|Y1273_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1273c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1273c PE=1 SV=1 611 837 8.0E-12
sp|P9WQJ0|Y1273_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1311 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1311 PE=3 SV=1 611 837 8.0E-12
sp|Q23868|TAGC_DICDI Serine protease/ABC transporter B family protein tagC OS=Dictyostelium discoideum GN=tagC PE=2 SV=2 638 837 8.0E-12
sp|P26361|CFTR_MOUSE Cystic fibrosis transmembrane conductance regulator OS=Mus musculus GN=Cftr PE=1 SV=2 1216 1437 9.0E-12
sp|Q6LPK6|MSBA_PHOPR Lipid A export ATP-binding/permease protein MsbA OS=Photobacterium profundum GN=msbA PE=3 SV=1 624 837 9.0E-12
sp|Q2QL74|CFTR_DIDVI Cystic fibrosis transmembrane conductance regulator OS=Didelphis virginiana GN=CFTR PE=3 SV=1 1183 1437 1.0E-11
sp|Q00554|CFTR_RABIT Cystic fibrosis transmembrane conductance regulator OS=Oryctolagus cuniculus GN=CFTR PE=2 SV=4 1235 1437 1.0E-11
sp|P35071|CFTR_BOVIN Cystic fibrosis transmembrane conductance regulator OS=Bos taurus GN=CFTR PE=2 SV=2 1235 1437 1.0E-11
sp|P35598|EXP8_STRPN Putative ABC transporter ATP-binding protein exp8 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=exp8 PE=3 SV=3 631 837 1.0E-11
sp|Q03519|TAP2_HUMAN Antigen peptide transporter 2 OS=Homo sapiens GN=TAP2 PE=1 SV=1 625 787 1.0E-11
sp|Q08D64|ABCB6_XENTR ATP-binding cassette sub-family B member 6, mitochondrial OS=Xenopus tropicalis GN=abcb6 PE=2 SV=1 634 837 1.0E-11
sp|P0C529|NDVA_BRUAB Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella abortus biovar 1 (strain 9-941) GN=ndvA PE=3 SV=1 596 851 1.0E-11
sp|Q2YQ73|NDVA_BRUA2 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella abortus (strain 2308) GN=ndvA PE=1 SV=1 596 851 1.0E-11
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 637 844 1.0E-11
sp|Q483B6|MSBA1_COLP3 Lipid A export ATP-binding/permease protein MsbA 1 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=msbA1 PE=3 SV=1 633 832 1.0E-11
sp|P36619|PMD1_SCHPO Leptomycin B resistance protein pmd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmd1 PE=3 SV=2 600 832 1.0E-11
sp|Q00449|MDR49_DROME Multidrug resistance protein homolog 49 OS=Drosophila melanogaster GN=Mdr49 PE=2 SV=2 632 837 1.0E-11
sp|P97046|LMRA_LACLM Multidrug resistance ABC transporter ATP-binding and permease protein OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=lmrA PE=3 SV=3 633 837 1.0E-11
sp|Q9LSJ5|AB18B_ARATH ABC transporter B family member 18 OS=Arabidopsis thaliana GN=ABCB18 PE=3 SV=1 637 837 1.0E-11
sp|Q00555|CFTR_SHEEP Cystic fibrosis transmembrane conductance regulator OS=Ovis aries GN=CFTR PE=1 SV=2 1235 1437 2.0E-11
sp|Q09YJ4|CFTR_MUNMU Cystic fibrosis transmembrane conductance regulator OS=Muntiacus muntjak GN=CFTR PE=3 SV=1 1235 1437 2.0E-11
sp|Q0VQP5|MSBA_ALCBS Lipid A export ATP-binding/permease protein MsbA OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=msbA PE=3 SV=1 637 844 2.0E-11
sp|Q8YH20|NDVA_BRUME Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ndvA PE=3 SV=1 596 851 2.0E-11
sp|B5X0E4|ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus GN=Abcb5 PE=2 SV=1 637 837 2.0E-11
sp|Q60AA3|MSBA_METCA Lipid A export ATP-binding/permease protein MsbA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=msbA PE=3 SV=1 631 859 2.0E-11
sp|Q9C7F2|AB14B_ARATH ABC transporter B family member 14 OS=Arabidopsis thaliana GN=ABCB14 PE=3 SV=1 638 843 2.0E-11
sp|Q9CHL8|LMRA_LACLA Multidrug resistance ABC transporter ATP-binding and permease protein OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lmrA PE=1 SV=2 633 837 2.0E-11
sp|P71355|Y663_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_0663 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0663 PE=3 SV=1 624 837 2.0E-11
sp|Q1WSB8|ECFA1_LACS1 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus salivarius (strain UCC118) GN=ecfA1 PE=3 SV=1 624 874 2.0E-11
sp|Q5D1Z7|CFTR_TRIVU Cystic fibrosis transmembrane conductance regulator OS=Trichosurus vulpecula GN=CFTR PE=2 SV=1 1235 1437 3.0E-11
sp|Q2IBB3|CFTR_RHIFE Cystic fibrosis transmembrane conductance regulator OS=Rhinolophus ferrumequinum GN=CFTR PE=3 SV=1 830 1438 3.0E-11
sp|Q07DW5|CFTR_MUNRE Cystic fibrosis transmembrane conductance regulator OS=Muntiacus reevesi GN=CFTR PE=3 SV=1 1235 1437 3.0E-11
sp|Q9JI39|ABCBA_MOUSE ATP-binding cassette sub-family B member 10, mitochondrial OS=Mus musculus GN=Abcb10 PE=1 SV=1 638 844 3.0E-11
sp|Q8G0T8|NDVA_BRUSU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella suis biovar 1 (strain 1330) GN=ndvA PE=3 SV=1 596 851 3.0E-11
sp|Q2M3G0|ABCB5_HUMAN ATP-binding cassette sub-family B member 5 OS=Homo sapiens GN=ABCB5 PE=1 SV=4 638 837 3.0E-11
sp|O70595|ABCB6_RAT ATP-binding cassette sub-family B member 6, mitochondrial OS=Rattus norvegicus GN=Abcb6 PE=2 SV=1 599 866 3.0E-11
sp|Q2G506|ATM1_NOVAD ATM1-type heavy metal exporter OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=atm1 PE=1 SV=1 621 832 3.0E-11
sp|Q7N6C6|MSBA_PHOLL Lipid A export ATP-binding/permease protein MsbA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=msbA PE=3 SV=1 631 846 3.0E-11
sp|Q07E16|CFTR_MUSPF Cystic fibrosis transmembrane conductance regulator OS=Mustela putorius furo GN=CFTR PE=3 SV=1 1235 1437 4.0E-11
sp|Q1GZI0|MSBA_METFK Lipid A export ATP-binding/permease protein MsbA OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=msbA PE=3 SV=1 623 837 4.0E-11
sp|Q83D84|MSBA_COXBU Lipid A export ATP-binding/permease protein MsbA OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=msbA PE=3 SV=1 628 837 4.0E-11
sp|Q7NZU6|MSBA_CHRVO Lipid A export ATP-binding/permease protein MsbA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=msbA PE=3 SV=1 631 832 4.0E-11
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 637 844 4.0E-11
sp|Q07DY5|CFTR_COLGU Cystic fibrosis transmembrane conductance regulator OS=Colobus guereza GN=CFTR PE=3 SV=1 1235 1437 5.0E-11
sp|Q09YK5|CFTR_ATEGE Cystic fibrosis transmembrane conductance regulator OS=Ateles geoffroyi GN=CFTR PE=3 SV=1 1235 1437 5.0E-11
sp|Q6PQZ2|CFTR_PIG Cystic fibrosis transmembrane conductance regulator OS=Sus scrofa GN=CFTR PE=2 SV=1 1235 1437 5.0E-11
sp|Q9C7F2|AB14B_ARATH ABC transporter B family member 14 OS=Arabidopsis thaliana GN=ABCB14 PE=3 SV=1 628 837 5.0E-11
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 637 844 5.0E-11
sp|Q4HVU7|ATM1_GIBZE Iron-sulfur clusters transporter ATM1, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ATM1 PE=3 SV=1 637 844 5.0E-11
sp|Q2QL83|CFTR_MICMU Cystic fibrosis transmembrane conductance regulator OS=Microcebus murinus GN=CFTR PE=3 SV=1 1235 1437 6.0E-11
sp|Q9NRK6|ABCBA_HUMAN ATP-binding cassette sub-family B member 10, mitochondrial OS=Homo sapiens GN=ABCB10 PE=1 SV=2 637 844 6.0E-11
sp|Q12C33|MSBA_POLSJ Lipid A export ATP-binding/permease protein MsbA OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=msbA PE=3 SV=1 626 843 6.0E-11
sp|Q54VC1|ABCCF_DICDI ABC transporter C family member 15 OS=Dictyostelium discoideum GN=abcC15 PE=3 SV=1 1209 1439 7.0E-11
sp|Q07E42|CFTR_DASNO Cystic fibrosis transmembrane conductance regulator OS=Dasypus novemcinctus GN=CFTR PE=3 SV=1 1235 1437 7.0E-11
sp|Q5U820|CFTR_CANLF Cystic fibrosis transmembrane conductance regulator OS=Canis lupus familiaris GN=CFTR PE=2 SV=2 1235 1437 7.0E-11
sp|P40416|ATM1_YEAST Iron-sulfur clusters transporter ATM1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATM1 PE=1 SV=2 638 832 7.0E-11
sp|P36370|TAP1_RAT Antigen peptide transporter 1 OS=Rattus norvegicus GN=Tap1 PE=1 SV=2 553 832 7.0E-11
sp|Q00PJ2|CFTR_ATEAB Cystic fibrosis transmembrane conductance regulator OS=Atelerix albiventris GN=CFTR PE=3 SV=1 1235 1437 1.0E-10
sp|Q2IBA1|CFTR_CHLAE Cystic fibrosis transmembrane conductance regulator OS=Chlorocebus aethiops GN=CFTR PE=3 SV=1 1235 1437 1.0E-10
sp|P13569|CFTR_HUMAN Cystic fibrosis transmembrane conductance regulator OS=Homo sapiens GN=CFTR PE=1 SV=3 1235 1437 1.0E-10
sp|Q2IBE4|CFTR_PONAB Cystic fibrosis transmembrane conductance regulator OS=Pongo abelii GN=CFTR PE=3 SV=1 1235 1437 1.0E-10
sp|Q07DV2|CFTR_AOTNA Cystic fibrosis transmembrane conductance regulator OS=Aotus nancymaae GN=CFTR PE=3 SV=1 1235 1437 1.0E-10
sp|Q09YH0|CFTR_SAIBB Cystic fibrosis transmembrane conductance regulator OS=Saimiri boliviensis boliviensis GN=CFTR PE=3 SV=1 1235 1437 1.0E-10
sp|Q2QLH0|CFTR_OTOGA Cystic fibrosis transmembrane conductance regulator OS=Otolemur garnettii GN=CFTR PE=3 SV=1 1235 1437 1.0E-10
sp|Q2QLF9|CFTR_CALJA Cystic fibrosis transmembrane conductance regulator OS=Callithrix jacchus GN=CFTR PE=3 SV=1 1235 1437 1.0E-10
sp|Q2QLE5|CFTR_PANTR Cystic fibrosis transmembrane conductance regulator OS=Pan troglodytes GN=CFTR PE=3 SV=1 1235 1437 1.0E-10
sp|Q2QLB4|CFTR_CALMO Cystic fibrosis transmembrane conductance regulator OS=Callicebus moloch GN=CFTR PE=3 SV=1 1235 1437 1.0E-10
sp|Q07DX5|CFTR_NOMLE Cystic fibrosis transmembrane conductance regulator OS=Nomascus leucogenys GN=CFTR PE=3 SV=1 1235 1437 1.0E-10
sp|Q108U0|CFTR_LOXAF Cystic fibrosis transmembrane conductance regulator OS=Loxodonta africana GN=CFTR PE=3 SV=1 1235 1437 1.0E-10
sp|P23702|LTXB_AGGAC Leukotoxin export ATP-binding protein LtxB OS=Aggregatibacter actinomycetemcomitans GN=ltxB PE=1 SV=1 630 850 1.0E-10
sp|Q6FIK3|ATM1_CANGA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATM1 PE=3 SV=1 597 875 1.0E-10
sp|Q9SYI3|AB5B_ARATH ABC transporter B family member 5 OS=Arabidopsis thaliana GN=ABCB5 PE=3 SV=1 638 844 1.0E-10
sp|Q9C7F8|AB13B_ARATH ABC transporter B family member 13 OS=Arabidopsis thaliana GN=ABCB13 PE=3 SV=1 631 837 1.0E-10
sp|Q6CX96|ATM1_KLULA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATM1 PE=3 SV=1 638 883 1.0E-10
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 637 844 1.0E-10
sp|Q15UY7|MSBA_PSEA6 Lipid A export ATP-binding/permease protein MsbA OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=msbA PE=3 SV=1 626 832 1.0E-10
sp|Q751N2|ATM1_ASHGO Iron-sulfur clusters transporter ATM1, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATM1 PE=3 SV=1 589 843 1.0E-10
sp|Q4PH16|ATM1_USTMA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ATM1 PE=3 SV=1 636 837 1.0E-10
sp|O53645|MDREP_MYCTU Multidrug efflux ATP-binding/permease protein Rv0194 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0194 PE=1 SV=1 636 837 1.0E-10
sp|Q0WML0|AB27B_ARATH ABC transporter B family member 27 OS=Arabidopsis thaliana GN=ABCB27 PE=1 SV=1 638 844 1.0E-10
sp|A1KF14|MDREP_MYCBP Multidrug efflux ATP-binding/permease protein BCG_0231 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_0231 PE=1 SV=1 636 837 1.0E-10
sp|Q2IBF6|CFTR_GORGO Cystic fibrosis transmembrane conductance regulator OS=Gorilla gorilla gorilla GN=CFTR PE=3 SV=1 1235 1437 2.0E-10
sp|Q2QLA3|CFTR_HORSE Cystic fibrosis transmembrane conductance regulator OS=Equus caballus GN=CFTR PE=3 SV=1 1235 1437 2.0E-10
sp|Q00552|CFTR_CAVPO Cystic fibrosis transmembrane conductance regulator OS=Cavia porcellus GN=CFTR PE=2 SV=2 1235 1437 2.0E-10
sp|Q47258|HLYB3_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 630 837 2.0E-10
sp|P10089|HLYBC_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=3 SV=2 630 837 2.0E-10
sp|P08716|HLYBP_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 630 837 2.0E-10
sp|Q8FDZ8|HLYB_ECOL6 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hlyB PE=3 SV=1 630 837 2.0E-10
sp|P26760|RTX1B_ACTPL Toxin RTX-I translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIB PE=1 SV=2 630 844 2.0E-10
sp|Q0A4U4|MSBA_ALKEH Lipid A export ATP-binding/permease protein MsbA OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=msbA PE=3 SV=1 630 832 2.0E-10
sp|Q9FWX7|AB11B_ARATH ABC transporter B family member 11 OS=Arabidopsis thaliana GN=ABCB11 PE=2 SV=1 638 844 2.0E-10
sp|Q2J0F4|NDVA_RHOP2 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain HaA2) GN=ndvA PE=3 SV=1 598 865 2.0E-10
sp|Q00553|CFTR_MACMU Cystic fibrosis transmembrane conductance regulator OS=Macaca mulatta GN=CFTR PE=2 SV=2 1235 1437 3.0E-10
sp|Q7JII7|CFTR_MACFU Cystic fibrosis transmembrane conductance regulator OS=Macaca fuscata fuscata GN=CFTR PE=3 SV=1 1235 1437 3.0E-10
sp|Q7JII8|CFTR_MACFA Cystic fibrosis transmembrane conductance regulator OS=Macaca fascicularis GN=CFTR PE=3 SV=1 1235 1437 3.0E-10
sp|Q9TSP5|CFTR_PAPAN Cystic fibrosis transmembrane conductance regulator OS=Papio anubis GN=CFTR PE=3 SV=1 1235 1437 3.0E-10
sp|Q9TUQ2|CFTR_MACNE Cystic fibrosis transmembrane conductance regulator OS=Macaca nemestrina GN=CFTR PE=3 SV=1 1235 1437 3.0E-10
sp|Q47908|MSBA_FRANO Lipid A export ATP-binding/permease protein MsbA OS=Francisella novicida GN=msbA PE=3 SV=2 624 837 3.0E-10
sp|P9WQJ9|IRTA_MYCTU Iron import ATP-binding/permease protein IrtA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtA PE=1 SV=1 611 843 3.0E-10
sp|P9WQJ8|IRTA_MYCTO Iron import ATP-binding/permease protein IrtA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtA PE=3 SV=1 611 843 3.0E-10
sp|P63392|IRTA_MYCBO Iron import ATP-binding/permease protein IrtA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtA PE=3 SV=1 611 843 3.0E-10
sp|Q6YUU5|MDR_ORYSJ Putative multidrug resistance protein OS=Oryza sativa subsp. japonica GN=Os02g0190300 PE=3 SV=1 637 864 3.0E-10
sp|P63398|Y1303_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb1303c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1303c PE=3 SV=1 635 832 4.0E-10
sp|P9WQJ3|Y1272_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1272c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1272c PE=1 SV=1 635 832 4.0E-10
sp|P9WQJ2|Y1272_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1310 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1310 PE=3 SV=1 635 832 4.0E-10
sp|Q54W24|ABCB4_DICDI ABC transporter B family member 4 OS=Dictyostelium discoideum GN=abcB4 PE=3 SV=1 638 837 4.0E-10
sp|Q6YUU5|MDR_ORYSJ Putative multidrug resistance protein OS=Oryza sativa subsp. japonica GN=Os02g0190300 PE=3 SV=1 638 832 4.0E-10
sp|Q7RX59|ATM1_NEUCR Iron-sulfur clusters transporter atm1, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fes-4 PE=3 SV=1 603 844 4.0E-10
sp|Q9M0G9|AB24B_ARATH ABC transporter B family member 24, mitochondrial OS=Arabidopsis thaliana GN=ABCB24 PE=2 SV=1 638 832 5.0E-10
sp|P21439|MDR3_HUMAN Phosphatidylcholine translocator ABCB4 OS=Homo sapiens GN=ABCB4 PE=1 SV=2 601 837 5.0E-10
sp|P70864|NDVA_BARBA Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella bacilliformis GN=ndvA PE=3 SV=2 586 837 6.0E-10
sp|A1USS5|NDVA_BARBK Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ndvA PE=3 SV=1 586 837 6.0E-10
sp|O80725|AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana GN=ABCB4 PE=1 SV=1 638 844 6.0E-10
sp|Q9LSJ6|AB17B_ARATH ABC transporter B family member 17 OS=Arabidopsis thaliana GN=ABCB17 PE=3 SV=1 388 862 6.0E-10
sp|Q9LHD1|AB15B_ARATH ABC transporter B family member 15 OS=Arabidopsis thaliana GN=ABCB15 PE=3 SV=1 638 837 6.0E-10
sp|Q6F9X0|MSBA_ACIAD Lipid A export ATP-binding/permease protein MsbA OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=msbA PE=3 SV=1 592 837 7.0E-10
sp|Q3IGX5|MSBA_PSEHT Lipid A export ATP-binding/permease protein MsbA OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=msbA PE=3 SV=1 624 842 7.0E-10
sp|P63359|MSBA_SALTY Lipid A export ATP-binding/permease protein MsbA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=msbA PE=1 SV=1 637 844 7.0E-10
sp|P63360|MSBA_SALTI Lipid A export ATP-binding/permease protein MsbA OS=Salmonella typhi GN=msbA PE=3 SV=1 637 844 7.0E-10
sp|Q57R14|MSBA_SALCH Lipid A export ATP-binding/permease protein MsbA OS=Salmonella choleraesuis (strain SC-B67) GN=msbA PE=3 SV=1 637 844 7.0E-10
sp|Q9FWX8|AB12B_ARATH ABC transporter B family member 12 OS=Arabidopsis thaliana GN=ABCB12 PE=2 SV=2 635 844 7.0E-10
sp|Q9M1Q9|AB21B_ARATH ABC transporter B family member 21 OS=Arabidopsis thaliana GN=ABCB21 PE=1 SV=2 638 844 8.0E-10
sp|Q9FHF1|AB7B_ARATH ABC transporter B family member 7 OS=Arabidopsis thaliana GN=ABCB7 PE=3 SV=1 600 872 8.0E-10
sp|Q00748|MDR65_DROME Multidrug resistance protein homolog 65 OS=Drosophila melanogaster GN=Mdr65 PE=1 SV=2 638 837 8.0E-10
sp|Q4QPI4|MSBA_HAEI8 Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus influenzae (strain 86-028NP) GN=msbA PE=3 SV=1 626 832 9.0E-10
sp|P45861|YWJA_BACSU Uncharacterized ABC transporter ATP-binding protein YwjA OS=Bacillus subtilis (strain 168) GN=ywjA PE=3 SV=1 600 846 9.0E-10
sp|Q6G2Z5|NDVA_BARHE Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ndvA PE=3 SV=1 641 869 9.0E-10
sp|Q5NIG3|MSBA_FRATT Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=msbA PE=3 SV=1 624 837 1.0E-09
sp|Q14JW6|MSBA_FRAT1 Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=msbA PE=1 SV=1 624 837 1.0E-09
sp|Q5RKI8|ABCB8_RAT ATP-binding cassette sub-family B member 8, mitochondrial OS=Rattus norvegicus GN=Abcb8 PE=2 SV=1 635 865 1.0E-09
sp|Q9M1Q9|AB21B_ARATH ABC transporter B family member 21 OS=Arabidopsis thaliana GN=ABCB21 PE=1 SV=2 600 837 1.0E-09
sp|Q1RDU4|MSBA_ECOUT Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli (strain UTI89 / UPEC) GN=msbA PE=3 SV=1 631 837 1.0E-09
sp|Q8FJB1|MSBA_ECOL6 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=msbA PE=3 SV=1 631 837 1.0E-09
sp|Q0TJD9|MSBA_ECOL5 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=msbA PE=3 SV=1 631 837 1.0E-09
sp|Q83LP0|MSBA_SHIFL Lipid A export ATP-binding/permease protein MsbA OS=Shigella flexneri GN=msbA PE=3 SV=1 631 837 1.0E-09
sp|Q32E34|MSBA_SHIDS Lipid A export ATP-binding/permease protein MsbA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=msbA PE=3 SV=1 631 837 1.0E-09
sp|Q31YT6|MSBA_SHIBS Lipid A export ATP-binding/permease protein MsbA OS=Shigella boydii serotype 4 (strain Sb227) GN=msbA PE=3 SV=1 631 837 1.0E-09
sp|P60752|MSBA_ECOLI Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli (strain K12) GN=msbA PE=1 SV=1 631 837 1.0E-09
sp|P60753|MSBA_ECO57 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O157:H7 GN=msbA PE=3 SV=1 631 837 1.0E-09
sp|Q3Z3K7|MSBA_SHISS Lipid A export ATP-binding/permease protein MsbA OS=Shigella sonnei (strain Ss046) GN=msbA PE=3 SV=1 631 837 1.0E-09
sp|Q9ZR72|AB1B_ARATH ABC transporter B family member 1 OS=Arabidopsis thaliana GN=ABCB1 PE=1 SV=1 599 866 1.0E-09
sp|O14286|ATM1_SCHPO Iron-sulfur clusters transporter atm1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atm1 PE=3 SV=2 602 844 1.0E-09
sp|Q03518|TAP1_HUMAN Antigen peptide transporter 1 OS=Homo sapiens GN=TAP1 PE=1 SV=2 551 837 1.0E-09
sp|P78966|MAM1_SCHPO Mating factor M secretion protein mam1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mam1 PE=3 SV=1 639 824 1.0E-09
sp|Q2QLC5|CFTR_CARPS Cystic fibrosis transmembrane conductance regulator OS=Carollia perspicillata GN=CFTR PE=3 SV=1 1235 1437 2.0E-09
sp|P0CE68|NFT1_YEAST ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NFT1 PE=3 SV=1 1154 1442 2.0E-09
sp|Q57180|Y1051_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_1051 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1051 PE=3 SV=1 600 832 2.0E-09
sp|Q8RY46|AB26B_ARATH ABC transporter B family member 26, chloroplastic OS=Arabidopsis thaliana GN=ABCB26 PE=2 SV=1 626 837 2.0E-09
sp|P75094|Y019_MYCPN Putative ABC transporter ATP-binding protein MG015 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_019 PE=3 SV=1 631 837 2.0E-09
sp|Q5ZUH9|MSBA_LEGPH Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=msbA PE=3 SV=2 634 837 2.0E-09
sp|Q9CXJ4|ABCB8_MOUSE ATP-binding cassette sub-family B member 8, mitochondrial OS=Mus musculus GN=Abcb8 PE=1 SV=1 635 865 2.0E-09
sp|Q66CI3|MSBA_YERPS Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=msbA PE=3 SV=1 631 832 2.0E-09
sp|Q1CGH0|MSBA_YERPN Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=msbA PE=3 SV=1 631 832 2.0E-09
sp|Q8ZGA9|MSBA_YERPE Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis GN=msbA PE=3 SV=1 631 832 2.0E-09
sp|Q1CA68|MSBA_YERPA Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=msbA PE=3 SV=1 631 832 2.0E-09
sp|Q5PGH0|MSBA_SALPA Lipid A export ATP-binding/permease protein MsbA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=msbA PE=3 SV=1 637 844 2.0E-09
sp|Q6FZF2|NDVA_BARQU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella quintana (strain Toulouse) GN=ndvA PE=3 SV=1 641 837 2.0E-09
sp|Q20Z38|NDVA_RHOPB Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisB18) GN=ndvA PE=3 SV=1 598 863 2.0E-09
sp|Q8LPK2|AB2B_ARATH ABC transporter B family member 2 OS=Arabidopsis thaliana GN=ABCB2 PE=1 SV=3 638 843 2.0E-09
sp|Q8LPK2|AB2B_ARATH ABC transporter B family member 2 OS=Arabidopsis thaliana GN=ABCB2 PE=1 SV=3 625 846 2.0E-09
sp|Q9FUT3|AB23B_ARATH ABC transporter B family member 23, mitochondrial OS=Arabidopsis thaliana GN=ABCB23 PE=2 SV=1 638 832 2.0E-09
sp|Q2HIE9|ATM1_CHAGB Iron-sulfur clusters transporter ATM1, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATM1 PE=3 SV=1 599 844 2.0E-09
sp|Q00748|MDR65_DROME Multidrug resistance protein homolog 65 OS=Drosophila melanogaster GN=Mdr65 PE=1 SV=2 638 832 2.0E-09
sp|Q04EY5|ECFA1_OENOB Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=ecfA1 PE=3 SV=1 631 837 2.0E-09
sp|Q2QLB4|CFTR_CALMO Cystic fibrosis transmembrane conductance regulator OS=Callicebus moloch GN=CFTR PE=3 SV=1 195 481 3.0E-09
sp|Q9VL32|SUR_DROME ATP-binding cassette sub-family C member Sur OS=Drosophila melanogaster GN=Sur PE=1 SV=4 1243 1433 3.0E-09
sp|Q7VL52|MSBA_HAEDU Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=msbA PE=3 SV=1 631 854 3.0E-09
sp|Q492S9|MSBA_BLOPB Lipid A export ATP-binding/permease protein MsbA OS=Blochmannia pennsylvanicus (strain BPEN) GN=msbA PE=3 SV=1 623 844 3.0E-09
sp|Q08201|MDR3_RAT Phosphatidylcholine translocator ABCB4 OS=Rattus norvegicus GN=Abcb4 PE=1 SV=1 601 860 3.0E-09
sp|Q9GTN7|TAGA_DICDI Serine protease/ABC transporter B family protein tagA OS=Dictyostelium discoideum GN=tagA PE=1 SV=2 625 789 3.0E-09
sp|Q8LPQ6|AB28B_ARATH ABC transporter B family member 28 OS=Arabidopsis thaliana GN=ABCB28 PE=2 SV=1 366 843 3.0E-09
sp|Q0BKJ3|MSBA_FRATO Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=msbA PE=3 SV=1 624 837 4.0E-09
sp|Q2A1U9|MSBA_FRATH Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain LVS) GN=msbA PE=3 SV=1 624 837 4.0E-09
sp|Q5WVN2|MSBA_LEGPL Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila (strain Lens) GN=msbA PE=3 SV=1 634 837 4.0E-09
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 600 837 4.0E-09
sp|Q7VR44|MSBA_BLOFL Lipid A export ATP-binding/permease protein MsbA OS=Blochmannia floridanus GN=msbA PE=3 SV=1 623 832 4.0E-09
sp|P0AAG5|MDLB_ECOLI Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli (strain K12) GN=mdlB PE=1 SV=1 596 843 5.0E-09
sp|P0AAG6|MDLB_ECOL6 Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdlB PE=3 SV=1 596 843 5.0E-09
sp|P0AAG7|MDLB_ECO57 Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli O157:H7 GN=mdlB PE=3 SV=1 596 843 5.0E-09
sp|P23174|MDR3_CRIGR Phosphatidylcholine translocator ABCB4 OS=Cricetulus griseus GN=ABCB4 PE=2 SV=1 601 837 5.0E-09
sp|Q8T9W1|TAGD_DICDI Serine protease/ABC transporter B family protein tagD OS=Dictyostelium discoideum GN=tagD PE=3 SV=1 638 837 5.0E-09
sp|P21441|MDR_LEITA Multidrug resistance protein OS=Leishmania tarentolae GN=PGPA PE=3 SV=2 553 850 6.0E-09
sp|Q56A55|ABCB8_DANRE ATP-binding cassette sub-family B member 8, mitochondrial OS=Danio rerio GN=abcb8 PE=2 SV=1 632 832 6.0E-09
sp|Q2M3G0|ABCB5_HUMAN ATP-binding cassette sub-family B member 5 OS=Homo sapiens GN=ABCB5 PE=1 SV=4 599 832 6.0E-09
sp|Q9FNU2|AB25B_ORYSJ ABC transporter B family member 25 OS=Oryza sativa subsp. japonica GN=OsABCB25 PE=2 SV=1 638 871 6.0E-09
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 632 866 6.0E-09
sp|P47261|Y015_MYCGE Putative ABC transporter ATP-binding protein MG015 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG015 PE=3 SV=1 633 843 7.0E-09
sp|Q9JXR3|MSBA_NEIMB Lipid A export ATP-binding/permease protein MsbA OS=Neisseria meningitidis serogroup B (strain MC58) GN=msbA PE=3 SV=1 626 843 7.0E-09
sp|Q8TI16|ECFA_METAC Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=ecfA PE=3 SV=1 634 832 7.0E-09
sp|Q4KJB2|MSBA_PSEF5 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=msbA PE=3 SV=1 624 846 8.0E-09
sp|Q4FS42|MSBA_PSYA2 Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=msbA PE=3 SV=1 639 832 9.0E-09
sp|Q2QLF9|CFTR_CALJA Cystic fibrosis transmembrane conductance regulator OS=Callithrix jacchus GN=CFTR PE=3 SV=1 195 481 1.0E-08
sp|Q9JW59|MSBA_NEIMA Lipid A export ATP-binding/permease protein MsbA OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=msbA PE=3 SV=1 626 843 1.0E-08
sp|Q5P2S7|MSBA_AROAE Lipid A export ATP-binding/permease protein MsbA OS=Aromatoleum aromaticum (strain EbN1) GN=msbA PE=3 SV=1 624 843 1.0E-08
sp|Q6D437|MSBA_PECAS Lipid A export ATP-binding/permease protein MsbA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=msbA PE=3 SV=2 639 843 1.0E-08
sp|Q9M3B9|AB20B_ARATH ABC transporter B family member 20 OS=Arabidopsis thaliana GN=ABCB20 PE=1 SV=1 638 851 1.0E-08
sp|Q07DV2|CFTR_AOTNA Cystic fibrosis transmembrane conductance regulator OS=Aotus nancymaae GN=CFTR PE=3 SV=1 195 481 2.0E-08
sp|Q2NUA5|MSBA_SODGM Lipid A export ATP-binding/permease protein MsbA OS=Sodalis glossinidius (strain morsitans) GN=msbA PE=3 SV=1 631 837 2.0E-08
sp|P11599|HLYB_PROVU Alpha-hemolysin translocation ATP-binding protein HlyB OS=Proteus vulgaris GN=hlyB PE=3 SV=1 648 837 2.0E-08
sp|B5X0E4|ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus GN=Abcb5 PE=2 SV=1 599 832 2.0E-08
sp|Q5X498|MSBA_LEGPA Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila (strain Paris) GN=msbA PE=3 SV=1 634 837 2.0E-08
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 601 837 2.0E-08
sp|Q8LPT1|AB6B_ARATH ABC transporter B family member 6 OS=Arabidopsis thaliana GN=ABCB6 PE=1 SV=2 638 851 2.0E-08
sp|Q54VC1|ABCCF_DICDI ABC transporter C family member 15 OS=Dictyostelium discoideum GN=abcC15 PE=3 SV=1 196 574 3.0E-08
sp|Q2IBA1|CFTR_CHLAE Cystic fibrosis transmembrane conductance regulator OS=Chlorocebus aethiops GN=CFTR PE=3 SV=1 594 785 3.0E-08
sp|Q00553|CFTR_MACMU Cystic fibrosis transmembrane conductance regulator OS=Macaca mulatta GN=CFTR PE=2 SV=2 594 785 3.0E-08
sp|Q7JII7|CFTR_MACFU Cystic fibrosis transmembrane conductance regulator OS=Macaca fuscata fuscata GN=CFTR PE=3 SV=1 594 785 3.0E-08
sp|Q7JII8|CFTR_MACFA Cystic fibrosis transmembrane conductance regulator OS=Macaca fascicularis GN=CFTR PE=3 SV=1 594 785 3.0E-08
sp|Q9TSP5|CFTR_PAPAN Cystic fibrosis transmembrane conductance regulator OS=Papio anubis GN=CFTR PE=3 SV=1 594 785 3.0E-08
sp|Q9TUQ2|CFTR_MACNE Cystic fibrosis transmembrane conductance regulator OS=Macaca nemestrina GN=CFTR PE=3 SV=1 594 785 3.0E-08
sp|Q07DY5|CFTR_COLGU Cystic fibrosis transmembrane conductance regulator OS=Colobus guereza GN=CFTR PE=3 SV=1 594 785 3.0E-08
sp|P54719|YFIC_BACSU Uncharacterized ABC transporter ATP-binding protein YfiC OS=Bacillus subtilis (strain 168) GN=yfiC PE=3 SV=1 626 837 3.0E-08
sp|Q9HUG8|MSBA_PSEAE Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=msbA PE=3 SV=1 624 843 3.0E-08
sp|Q1QBW0|MSBA_PSYCK Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter cryohalolentis (strain K5) GN=msbA PE=3 SV=1 639 832 3.0E-08
sp|Q8K984|MDLB_BUCAP Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=mdlB PE=3 SV=1 615 837 3.0E-08
sp|P54683|TAGB_DICDI Serine protease/ABC transporter B family protein tagB OS=Dictyostelium discoideum GN=tagB PE=3 SV=2 638 837 3.0E-08
sp|Q9EXN5|MCHF_ECOLX Probable microcin-H47 secretion/processing ATP-binding protein MchF OS=Escherichia coli GN=mchF PE=3 SV=1 626 789 3.0E-08
sp|Q2QLA3|CFTR_HORSE Cystic fibrosis transmembrane conductance regulator OS=Equus caballus GN=CFTR PE=3 SV=1 546 785 4.0E-08
sp|P44407|MSBA_HAEIN Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=msbA PE=3 SV=1 626 832 4.0E-08
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 600 837 4.0E-08
sp|Q06034|MDR1_LEIEN Multidrug resistance protein 1 OS=Leishmania enriettii GN=MDR1 PE=3 SV=1 635 837 4.0E-08
sp|P22520|CVAB_ECOLX Colicin V secretion/processing ATP-binding protein CvaB OS=Escherichia coli GN=cvaB PE=3 SV=1 625 785 4.0E-08
sp|Q07E42|CFTR_DASNO Cystic fibrosis transmembrane conductance regulator OS=Dasypus novemcinctus GN=CFTR PE=3 SV=1 546 785 5.0E-08
sp|Q9FHF1|AB7B_ARATH ABC transporter B family member 7 OS=Arabidopsis thaliana GN=ABCB7 PE=3 SV=1 638 843 5.0E-08
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 638 837 5.0E-08
sp|P26361|CFTR_MOUSE Cystic fibrosis transmembrane conductance regulator OS=Mus musculus GN=Cftr PE=1 SV=2 195 483 8.0E-08
sp|Q54LE6|ABCC5_DICDI ABC transporter C family member 5 OS=Dictyostelium discoideum GN=abcC5 PE=3 SV=1 552 855 9.0E-08
sp|Q9ZNB0|Y742_STRCO Uncharacterized ABC transporter ATP-binding protein SCO0742 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO0742 PE=3 SV=1 630 823 9.0E-08
sp|Q3SFZ6|MSBA_THIDA Lipid A export ATP-binding/permease protein MsbA OS=Thiobacillus denitrificans (strain ATCC 25259) GN=msbA PE=3 SV=1 626 832 1.0E-07
sp|P78966|MAM1_SCHPO Mating factor M secretion protein mam1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mam1 PE=3 SV=1 632 837 1.0E-07
sp|Q00PJ2|CFTR_ATEAB Cystic fibrosis transmembrane conductance regulator OS=Atelerix albiventris GN=CFTR PE=3 SV=1 546 785 2.0E-07
sp|O80725|AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana GN=ABCB4 PE=1 SV=1 636 889 2.0E-07
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 600 837 2.0E-07
sp|Q2IBF6|CFTR_GORGO Cystic fibrosis transmembrane conductance regulator OS=Gorilla gorilla gorilla GN=CFTR PE=3 SV=1 594 785 3.0E-07
sp|P13569|CFTR_HUMAN Cystic fibrosis transmembrane conductance regulator OS=Homo sapiens GN=CFTR PE=1 SV=3 594 785 3.0E-07
sp|Q2IBE4|CFTR_PONAB Cystic fibrosis transmembrane conductance regulator OS=Pongo abelii GN=CFTR PE=3 SV=1 594 785 3.0E-07
sp|Q47JR8|MSBA_DECAR Lipid A export ATP-binding/permease protein MsbA OS=Dechloromonas aromatica (strain RCB) GN=msbA PE=3 SV=1 631 832 3.0E-07
sp|Q54BT3|ABCB2_DICDI ABC transporter B family member 2 OS=Dictyostelium discoideum GN=abcB2 PE=3 SV=1 638 844 3.0E-07
sp|O53645|MDREP_MYCTU Multidrug efflux ATP-binding/permease protein Rv0194 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0194 PE=1 SV=1 618 843 3.0E-07
sp|A1KF14|MDREP_MYCBP Multidrug efflux ATP-binding/permease protein BCG_0231 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_0231 PE=1 SV=1 631 843 3.0E-07
sp|Q88D92|MSBA_PSEPK Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas putida (strain KT2440) GN=msbA PE=3 SV=1 624 843 4.0E-07
sp|Q2QL74|CFTR_DIDVI Cystic fibrosis transmembrane conductance regulator OS=Didelphis virginiana GN=CFTR PE=3 SV=1 594 785 5.0E-07
sp|Q9NUT2|ABCB8_HUMAN ATP-binding cassette sub-family B member 8, mitochondrial OS=Homo sapiens GN=ABCB8 PE=1 SV=3 635 837 5.0E-07
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 638 837 5.0E-07
sp|O70127|ABCBB_RAT Bile salt export pump OS=Rattus norvegicus GN=Abcb11 PE=1 SV=1 638 837 5.0E-07
sp|Q2QLB4|CFTR_CALMO Cystic fibrosis transmembrane conductance regulator OS=Callicebus moloch GN=CFTR PE=3 SV=1 594 789 6.0E-07
sp|P36619|PMD1_SCHPO Leptomycin B resistance protein pmd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmd1 PE=3 SV=2 638 837 6.0E-07
sp|Q09YH0|CFTR_SAIBB Cystic fibrosis transmembrane conductance regulator OS=Saimiri boliviensis boliviensis GN=CFTR PE=3 SV=1 594 789 7.0E-07
sp|Q09YK5|CFTR_ATEGE Cystic fibrosis transmembrane conductance regulator OS=Ateles geoffroyi GN=CFTR PE=3 SV=1 594 789 7.0E-07
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum GN=abcC8 PE=3 SV=1 631 833 9.0E-07
sp|Q07DV2|CFTR_AOTNA Cystic fibrosis transmembrane conductance regulator OS=Aotus nancymaae GN=CFTR PE=3 SV=1 594 789 9.0E-07
sp|Q2QLF9|CFTR_CALJA Cystic fibrosis transmembrane conductance regulator OS=Callithrix jacchus GN=CFTR PE=3 SV=1 594 789 1.0E-06
sp|Q2QL83|CFTR_MICMU Cystic fibrosis transmembrane conductance regulator OS=Microcebus murinus GN=CFTR PE=3 SV=1 546 785 1.0E-06
sp|P26361|CFTR_MOUSE Cystic fibrosis transmembrane conductance regulator OS=Mus musculus GN=Cftr PE=1 SV=2 594 785 1.0E-06
sp|Q108U0|CFTR_LOXAF Cystic fibrosis transmembrane conductance regulator OS=Loxodonta africana GN=CFTR PE=3 SV=1 546 785 1.0E-06
sp|Q5RFQ9|ABCB8_PONAB ATP-binding cassette sub-family B member 8, mitochondrial OS=Pongo abelii GN=ABCB8 PE=2 SV=1 635 837 1.0E-06
sp|Q9FWX7|AB11B_ARATH ABC transporter B family member 11 OS=Arabidopsis thaliana GN=ABCB11 PE=2 SV=1 636 846 1.0E-06
sp|Q07DW5|CFTR_MUNRE Cystic fibrosis transmembrane conductance regulator OS=Muntiacus reevesi GN=CFTR PE=3 SV=1 546 785 2.0E-06
sp|Q09YJ4|CFTR_MUNMU Cystic fibrosis transmembrane conductance regulator OS=Muntiacus muntjak GN=CFTR PE=3 SV=1 546 785 2.0E-06
sp|Q8T9W4|ABCB3_DICDI ABC transporter B family member 3 OS=Dictyostelium discoideum GN=abcB3 PE=3 SV=1 637 837 2.0E-06
sp|Q9QY30|ABCBB_MOUSE Bile salt export pump OS=Mus musculus GN=Abcb11 PE=1 SV=2 638 837 2.0E-06
sp|Q00554|CFTR_RABIT Cystic fibrosis transmembrane conductance regulator OS=Oryctolagus cuniculus GN=CFTR PE=2 SV=4 546 785 3.0E-06
sp|Q07E16|CFTR_MUSPF Cystic fibrosis transmembrane conductance regulator OS=Mustela putorius furo GN=CFTR PE=3 SV=1 546 785 3.0E-06
sp|P34158|CFTR_RAT Cystic fibrosis transmembrane conductance regulator OS=Rattus norvegicus GN=Cftr PE=1 SV=3 594 785 3.0E-06
sp|Q9SYI3|AB5B_ARATH ABC transporter B family member 5 OS=Arabidopsis thaliana GN=ABCB5 PE=3 SV=1 636 837 3.0E-06
sp|P53706|HST6_CANAW Alpha-factor-transporting ATPase OS=Candida albicans (strain WO-1) GN=HST6 PE=3 SV=1 1356 1448 3.0E-06
sp|P35071|CFTR_BOVIN Cystic fibrosis transmembrane conductance regulator OS=Bos taurus GN=CFTR PE=2 SV=2 546 785 4.0E-06
sp|Q9FWX8|AB12B_ARATH ABC transporter B family member 12 OS=Arabidopsis thaliana GN=ABCB12 PE=2 SV=2 636 837 7.0E-06
sp|Q2QLH0|CFTR_OTOGA Cystic fibrosis transmembrane conductance regulator OS=Otolemur garnettii GN=CFTR PE=3 SV=1 546 785 8.0E-06
sp|Q06034|MDR1_LEIEN Multidrug resistance protein 1 OS=Leishmania enriettii GN=MDR1 PE=3 SV=1 656 837 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0005524 ATP binding Yes
GO:0016021 integral component of membrane Yes
GO:0140359 ABC-type transporter activity Yes
GO:0006810 transport No
GO:0032555 purine ribonucleotide binding No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0042626 ATPase-coupled transmembrane transporter activity No
GO:0043167 ion binding No
GO:0051179 localization No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No
GO:0031224 intrinsic component of membrane No
GO:0140657 ATP-dependent activity No
GO:0022804 active transmembrane transporter activity No
GO:0043168 anion binding No
GO:0008150 biological_process No
GO:0022857 transmembrane transporter activity No
GO:0005488 binding No
GO:0009987 cellular process No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0005575 cellular_component No
GO:0032553 ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0097159 organic cyclic compound binding No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0015399 primary active transmembrane transporter activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.5

Transmembrane Domains

Domain # Start End Length
1 31 53 22
2 66 88 22
3 98 120 22
4 127 149 22
5 159 178 19
6 310 332 22
7 397 419 22
8 491 513 22
9 896 918 22
10 938 960 22
11 1022 1056 34
12 1126 1148 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 2.82 1.05 4.59
CcL In ants, during behavior modification 1059.01 0.00 2218.03
CcD In ants, recently dead 449.69 119.86 779.52

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.078582 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4559
MSGTPPCSIAVEDRFGPAVTDSCLGGFDFTLLFEESILTLVPLAIALLWAASRALTLRIEPAKVKASWLLAAKMF
LYFSYVILQVALLGLWVARGTPQTRLTVACLVLTIVGYVALSLTSYMEHLRSVRPSSMLSLYLSISLLVDMARVR
TLFFMPDSRTLAGILLASLLLKVLLFCLESTEKRHLLRENWKSVSPEDTGGFYNRALFVWLNAVFRKGFRTLLTI
ATLTPLDDEMLEASNPTKLIERWEKAGKSSEHSLAWTFVVHYKWCIFSGILPRLAYTGFSFSQPYLIQRVLDFTS
EPENPNSRNISYGLVGAYAIVYIGLSLSFAIYQHKTYRLLTLFRGSLVTLIFNKTLRVSSTSIADGEAITLMSAD
IDRVGSVTLIHEFYASFIEAAIALWLLYSLLGIAVVAPVLWIIVCLIGGIPLARAAGNAQTPWLEAIEERLAATS
KALNAMKPIKMTGLADIVSSQIANFRLLEIRASLRHRVLNIFVFVAYFASSGLAPVWGFGVYILLARSRNSGTLT
ESTAFAALSAFELLNQPMMNAIDGFEHVQTVLNSFRRIQEYLVSEEREDYRISSLDRTPSDSDLSRSQENEKVEK
PRIKDMSDAWPDSIRDDSITAAVVNDASAQYSEEGEPVLRNLSFEVHRSQITMIYGPVGSGKSTLLKLLLGEMPI
TSGSVTANFSRTAYCPQTPWITWGSVQQNIVGMSSFDNAWYDTVVRACALLPDFEELTNGDKTHAGIRGARLSGG
QQMRVSFARALYSRNATMILDDVLTGLDRATERTILDAVFSPQGLLRQQKSTVVWTTNSAHHLSYADHVICLDKD
GKIAEQGPLDKLSIAANGVQSLSSQPIMETSRPELEIPEDALHELEILEEQEPEETRRAGDMRIYAYYAKTAGWW
TTLIYLFACAAFVYGAIFPSVWLQWWTNANAERPNERIGYWLGVYGVLAAVTMVGCTLADCVFNLAVLPTTARRF
HELLLSTTMRAPTSFLTSTNAGTTLNRFSQDLELIDNDLPMAIDQTIFQFFSVIASAVLVFIGSGYVAAAIPFVF
VALAVIQFYYLRTSRQLRLLDIEAKAPLLSQFLETLNGISCVRAYGWSHKYMDRNHEALNVSQRPFYLLWCIQRW
LTLVLDLLNAAIAILLVGVATNVRGGSSAFLGVALFNVIALSSSLQTLITEWTQVETALGAIKRIRSYVTTTEDE
NLPSENGTVADEWPQEGEITFKDISASYGPSTEAVLKEISFSIKPGEKVAICGRTGSGKSSLVAALLRMLEVENG
TILIDGVDISTIPRQEVRSRLNTVPQDPFFLHGSVRQNVDPLEMADDERIKQVLRTLNLWDIFEKQEGLDEEVTQ
ETLSHGQRQLFCLARSMIKKGKIVVMDEATSSVDAETDELMQRVLRDEFNGRTVITIAHKLHTVLDYDRVVLLDK
GKVVETGNPQELLRTTDSAFRELYEKLRNNVE
Coding >Ophio5|4559
ATGTCGGGCACTCCCCCATGTTCCATTGCTGTCGAGGATCGGTTCGGCCCAGCCGTTACTGATTCCTGCCTCGGA
GGCTTCGACTTCACTCTTCTCTTCGAGGAGAGCATACTCACTCTTGTTCCCCTGGCGATCGCTTTGCTTTGGGCG
GCGTCGCGAGCTCTCACCCTCCGAATTGAGCCTGCCAAGGTTAAGGCATCATGGCTGCTCGCGGCGAAAATGTTT
CTGTACTTCAGCTACGTGATCCTACAAGTCGCGCTTTTGGGTCTGTGGGTTGCGCGTGGCACGCCTCAAACGCGA
CTTACCGTGGCGTGCCTGGTCTTGACCATTGTCGGCTATGTCGCCCTCTCGCTCACGTCTTACATGGAGCACCTG
CGCTCAGTCCGACCTTCGTCCATGCTGTCCCTCTATCTTAGTATTTCGCTTCTCGTGGACATGGCTCGTGTCCGT
ACACTGTTCTTCATGCCTGATAGCAGAACGCTGGCCGGTATCTTGCTGGCCAGCCTTCTGCTCAAAGTCTTACTC
TTCTGTCTGGAATCGACTGAGAAACGGCACCTTCTGCGCGAGAACTGGAAAAGTGTGTCGCCAGAGGACACCGGT
GGTTTTTACAATCGAGCTCTCTTTGTGTGGTTGAACGCCGTTTTCCGCAAGGGTTTCCGCACTCTCTTGACAATC
GCAACTCTGACTCCTCTGGACGACGAGATGCTGGAGGCTTCTAACCCGACCAAGTTGATCGAGCGGTGGGAAAAA
GCCGGCAAATCAAGCGAACATTCTTTGGCCTGGACCTTTGTGGTGCACTACAAGTGGTGCATCTTCTCCGGCATC
TTACCAAGATTGGCTTATACCGGTTTCAGTTTCTCACAGCCCTACCTGATTCAGCGTGTTCTCGACTTTACCTCC
GAGCCTGAAAATCCAAACTCGCGAAACATATCATATGGACTGGTCGGGGCATATGCTATTGTTTATATTGGACTT
TCTTTATCGTTTGCCATATATCAACACAAGACGTACCGCCTGCTCACGCTGTTTCGCGGCAGCCTGGTGACACTC
ATCTTCAACAAGACGCTTCGAGTCAGCTCAACGTCGATCGCAGACGGCGAGGCAATTACTCTCATGAGCGCCGAC
ATAGATCGAGTCGGCTCCGTCACTCTCATTCACGAGTTCTATGCCAGCTTCATCGAGGCCGCGATAGCCCTCTGG
CTTCTGTACAGCCTCCTCGGAATAGCCGTTGTGGCTCCCGTTCTCTGGATCATTGTTTGTCTCATCGGGGGAATT
CCTCTAGCCAGAGCGGCTGGTAATGCTCAAACTCCCTGGCTCGAGGCTATCGAAGAGCGCCTCGCGGCAACGTCC
AAGGCGCTAAATGCCATGAAACCAATCAAGATGACCGGTTTGGCCGACATCGTGTCTTCTCAGATTGCCAATTTC
AGGTTGTTGGAGATTCGCGCTTCTCTCCGCCATCGTGTCCTCAACATCTTCGTCTTTGTCGCGTACTTCGCGTCC
TCCGGCCTAGCCCCAGTGTGGGGGTTCGGCGTCTATATCCTTCTCGCAAGATCTAGAAATAGCGGGACCTTGACC
GAGAGCACTGCGTTTGCCGCCCTCAGTGCGTTCGAGCTCCTGAACCAGCCCATGATGAATGCCATCGACGGATTT
GAGCACGTTCAAACTGTCCTCAATTCCTTTCGGCGGATCCAAGAGTACTTGGTTAGCGAGGAGCGGGAAGACTAC
AGAATTTCCAGCCTGGACAGGACGCCTTCGGACTCTGATCTCTCCAGGTCTCAGGAAAACGAAAAGGTCGAAAAG
CCCCGGATCAAGGACATGTCGGACGCCTGGCCAGACTCCATCAGGGACGATTCAATCACAGCCGCCGTCGTGAAT
GATGCCTCAGCCCAATACTCGGAGGAAGGCGAGCCAGTGCTCCGAAACCTCAGCTTTGAAGTCCATCGCAGCCAG
ATAACGATGATCTACGGTCCGGTTGGCTCTGGAAAGTCGACGCTGCTGAAACTGCTACTGGGAGAAATGCCAATC
ACCTCTGGATCCGTCACCGCCAACTTTTCCAGAACAGCCTACTGCCCGCAGACGCCATGGATCACCTGGGGCAGC
GTTCAGCAAAACATCGTCGGCATGTCCTCCTTCGACAATGCTTGGTACGACACTGTAGTTCGTGCGTGCGCGCTA
CTCCCCGACTTTGAGGAGTTGACAAACGGAGACAAAACCCATGCCGGCATCAGAGGCGCTCGACTGAGCGGCGGG
CAGCAAATGCGGGTGTCCTTTGCTCGAGCACTTTACTCGAGAAATGCTACCATGATTCTGGACGACGTCCTTACA
GGCCTGGATCGGGCCACTGAACGGACCATCTTAGACGCCGTGTTCAGTCCTCAAGGATTGTTGAGACAACAGAAA
TCCACGGTGGTTTGGACCACAAACTCAGCCCATCACCTGAGTTATGCCGACCATGTGATTTGTCTGGACAAAGAT
GGAAAGATCGCGGAGCAAGGCCCCCTCGACAAACTGTCTATTGCTGCCAATGGCGTTCAGAGTCTTTCAAGCCAG
CCAATCATGGAAACCAGTCGTCCAGAGCTAGAAATCCCCGAGGATGCTCTCCATGAGCTGGAGATCCTCGAAGAG
CAGGAGCCAGAAGAGACCCGCCGTGCAGGAGACATGCGAATTTACGCCTACTATGCAAAGACGGCAGGCTGGTGG
ACAACCTTGATCTATCTATTTGCCTGTGCCGCCTTTGTGTACGGCGCCATCTTTCCCTCTGTCTGGTTGCAGTGG
TGGACAAATGCCAACGCGGAGCGTCCAAACGAGCGTATTGGCTACTGGCTTGGTGTCTATGGCGTACTCGCGGCC
GTGACCATGGTTGGCTGCACGCTGGCTGACTGTGTCTTCAACCTGGCCGTGCTTCCTACAACCGCACGAAGGTTC
CATGAGCTCCTGTTGAGCACCACAATGCGGGCGCCGACGTCTTTTCTGACGTCCACGAATGCGGGAACGACGCTG
AACAGGTTCAGCCAAGATCTCGAACTAATTGACAATGACCTGCCCATGGCTATTGATCAGACCATATTCCAGTTC
TTCTCAGTAATCGCTTCAGCCGTCCTTGTCTTCATTGGCTCTGGCTATGTCGCCGCTGCCATTCCTTTTGTTTTC
GTGGCGCTGGCCGTCATTCAGTTTTACTATCTCCGCACATCCCGGCAGCTGCGACTCCTCGACATCGAAGCCAAG
GCACCCCTTTTGTCCCAGTTCCTGGAGACGCTGAACGGTATTTCATGCGTCCGAGCATACGGCTGGTCGCACAAG
TACATGGATCGCAACCACGAGGCCCTCAACGTGTCGCAGAGGCCATTCTATCTGCTGTGGTGCATTCAGAGATGG
CTGACTCTCGTCTTGGACCTGCTGAATGCAGCAATTGCCATTCTTCTTGTCGGAGTTGCCACAAATGTCCGTGGG
GGGTCGAGTGCATTCCTTGGAGTCGCCTTGTTCAATGTCATAGCTCTCTCGTCATCCCTCCAGACTCTGATCACC
GAATGGACCCAGGTGGAGACCGCACTGGGAGCTATCAAGCGTATTCGATCTTACGTCACGACCACGGAGGATGAG
AACCTGCCAAGCGAAAATGGCACCGTTGCTGATGAATGGCCTCAAGAGGGAGAAATCACGTTCAAGGACATCTCG
GCCTCTTACGGGCCCTCTACTGAAGCAGTGCTGAAGGAAATCAGCTTCTCTATCAAGCCTGGCGAGAAGGTGGCC
ATCTGTGGCCGAACAGGCAGTGGCAAATCTTCACTGGTTGCAGCGCTGCTCAGAATGTTGGAGGTGGAAAACGGA
ACTATCTTGATAGATGGCGTAGATATCAGCACGATTCCCCGTCAAGAAGTGCGCAGTCGACTCAACACAGTGCCG
CAGGACCCTTTCTTCCTTCATGGCAGTGTTCGTCAGAATGTCGACCCCCTGGAGATGGCCGACGACGAACGCATT
AAGCAGGTGCTCCGTACCTTGAATCTCTGGGATATTTTCGAGAAGCAAGAGGGGCTCGATGAAGAAGTGACGCAG
GAAACGCTCTCCCACGGACAGCGACAACTGTTCTGCCTCGCCCGCAGTATGATCAAAAAGGGAAAGATTGTTGTC
ATGGATGAGGCAACAAGCAGCGTGGACGCTGAAACCGACGAACTCATGCAGCGAGTTCTCCGCGATGAGTTCAAT
GGGCGAACAGTCATCACCATCGCACACAAGCTTCATACCGTCCTGGATTACGATCGCGTGGTACTGCTTGACAAG
GGCAAGGTAGTCGAGACCGGCAACCCGCAAGAGCTGCTGCGAACAACCGACTCCGCGTTCCGTGAGCTCTACGAG
AAGCTCCGCAACAATGTCGAG
Transcript >Ophio5|4559
ATGTCGGGCACTCCCCCATGTTCCATTGCTGTCGAGGATCGGTTCGGCCCAGCCGTTACTGATTCCTGCCTCGGA
GGCTTCGACTTCACTCTTCTCTTCGAGGAGAGCATACTCACTCTTGTTCCCCTGGCGATCGCTTTGCTTTGGGCG
GCGTCGCGAGCTCTCACCCTCCGAATTGAGCCTGCCAAGGTTAAGGCATCATGGCTGCTCGCGGCGAAAATGTTT
CTGTACTTCAGCTACGTGATCCTACAAGTCGCGCTTTTGGGTCTGTGGGTTGCGCGTGGCACGCCTCAAACGCGA
CTTACCGTGGCGTGCCTGGTCTTGACCATTGTCGGCTATGTCGCCCTCTCGCTCACGTCTTACATGGAGCACCTG
CGCTCAGTCCGACCTTCGTCCATGCTGTCCCTCTATCTTAGTATTTCGCTTCTCGTGGACATGGCTCGTGTCCGT
ACACTGTTCTTCATGCCTGATAGCAGAACGCTGGCCGGTATCTTGCTGGCCAGCCTTCTGCTCAAAGTCTTACTC
TTCTGTCTGGAATCGACTGAGAAACGGCACCTTCTGCGCGAGAACTGGAAAAGTGTGTCGCCAGAGGACACCGGT
GGTTTTTACAATCGAGCTCTCTTTGTGTGGTTGAACGCCGTTTTCCGCAAGGGTTTCCGCACTCTCTTGACAATC
GCAACTCTGACTCCTCTGGACGACGAGATGCTGGAGGCTTCTAACCCGACCAAGTTGATCGAGCGGTGGGAAAAA
GCCGGCAAATCAAGCGAACATTCTTTGGCCTGGACCTTTGTGGTGCACTACAAGTGGTGCATCTTCTCCGGCATC
TTACCAAGATTGGCTTATACCGGTTTCAGTTTCTCACAGCCCTACCTGATTCAGCGTGTTCTCGACTTTACCTCC
GAGCCTGAAAATCCAAACTCGCGAAACATATCATATGGACTGGTCGGGGCATATGCTATTGTTTATATTGGACTT
TCTTTATCGTTTGCCATATATCAACACAAGACGTACCGCCTGCTCACGCTGTTTCGCGGCAGCCTGGTGACACTC
ATCTTCAACAAGACGCTTCGAGTCAGCTCAACGTCGATCGCAGACGGCGAGGCAATTACTCTCATGAGCGCCGAC
ATAGATCGAGTCGGCTCCGTCACTCTCATTCACGAGTTCTATGCCAGCTTCATCGAGGCCGCGATAGCCCTCTGG
CTTCTGTACAGCCTCCTCGGAATAGCCGTTGTGGCTCCCGTTCTCTGGATCATTGTTTGTCTCATCGGGGGAATT
CCTCTAGCCAGAGCGGCTGGTAATGCTCAAACTCCCTGGCTCGAGGCTATCGAAGAGCGCCTCGCGGCAACGTCC
AAGGCGCTAAATGCCATGAAACCAATCAAGATGACCGGTTTGGCCGACATCGTGTCTTCTCAGATTGCCAATTTC
AGGTTGTTGGAGATTCGCGCTTCTCTCCGCCATCGTGTCCTCAACATCTTCGTCTTTGTCGCGTACTTCGCGTCC
TCCGGCCTAGCCCCAGTGTGGGGGTTCGGCGTCTATATCCTTCTCGCAAGATCTAGAAATAGCGGGACCTTGACC
GAGAGCACTGCGTTTGCCGCCCTCAGTGCGTTCGAGCTCCTGAACCAGCCCATGATGAATGCCATCGACGGATTT
GAGCACGTTCAAACTGTCCTCAATTCCTTTCGGCGGATCCAAGAGTACTTGGTTAGCGAGGAGCGGGAAGACTAC
AGAATTTCCAGCCTGGACAGGACGCCTTCGGACTCTGATCTCTCCAGGTCTCAGGAAAACGAAAAGGTCGAAAAG
CCCCGGATCAAGGACATGTCGGACGCCTGGCCAGACTCCATCAGGGACGATTCAATCACAGCCGCCGTCGTGAAT
GATGCCTCAGCCCAATACTCGGAGGAAGGCGAGCCAGTGCTCCGAAACCTCAGCTTTGAAGTCCATCGCAGCCAG
ATAACGATGATCTACGGTCCGGTTGGCTCTGGAAAGTCGACGCTGCTGAAACTGCTACTGGGAGAAATGCCAATC
ACCTCTGGATCCGTCACCGCCAACTTTTCCAGAACAGCCTACTGCCCGCAGACGCCATGGATCACCTGGGGCAGC
GTTCAGCAAAACATCGTCGGCATGTCCTCCTTCGACAATGCTTGGTACGACACTGTAGTTCGTGCGTGCGCGCTA
CTCCCCGACTTTGAGGAGTTGACAAACGGAGACAAAACCCATGCCGGCATCAGAGGCGCTCGACTGAGCGGCGGG
CAGCAAATGCGGGTGTCCTTTGCTCGAGCACTTTACTCGAGAAATGCTACCATGATTCTGGACGACGTCCTTACA
GGCCTGGATCGGGCCACTGAACGGACCATCTTAGACGCCGTGTTCAGTCCTCAAGGATTGTTGAGACAACAGAAA
TCCACGGTGGTTTGGACCACAAACTCAGCCCATCACCTGAGTTATGCCGACCATGTGATTTGTCTGGACAAAGAT
GGAAAGATCGCGGAGCAAGGCCCCCTCGACAAACTGTCTATTGCTGCCAATGGCGTTCAGAGTCTTTCAAGCCAG
CCAATCATGGAAACCAGTCGTCCAGAGCTAGAAATCCCCGAGGATGCTCTCCATGAGCTGGAGATCCTCGAAGAG
CAGGAGCCAGAAGAGACCCGCCGTGCAGGAGACATGCGAATTTACGCCTACTATGCAAAGACGGCAGGCTGGTGG
ACAACCTTGATCTATCTATTTGCCTGTGCCGCCTTTGTGTACGGCGCCATCTTTCCCTCTGTCTGGTTGCAGTGG
TGGACAAATGCCAACGCGGAGCGTCCAAACGAGCGTATTGGCTACTGGCTTGGTGTCTATGGCGTACTCGCGGCC
GTGACCATGGTTGGCTGCACGCTGGCTGACTGTGTCTTCAACCTGGCCGTGCTTCCTACAACCGCACGAAGGTTC
CATGAGCTCCTGTTGAGCACCACAATGCGGGCGCCGACGTCTTTTCTGACGTCCACGAATGCGGGAACGACGCTG
AACAGGTTCAGCCAAGATCTCGAACTAATTGACAATGACCTGCCCATGGCTATTGATCAGACCATATTCCAGTTC
TTCTCAGTAATCGCTTCAGCCGTCCTTGTCTTCATTGGCTCTGGCTATGTCGCCGCTGCCATTCCTTTTGTTTTC
GTGGCGCTGGCCGTCATTCAGTTTTACTATCTCCGCACATCCCGGCAGCTGCGACTCCTCGACATCGAAGCCAAG
GCACCCCTTTTGTCCCAGTTCCTGGAGACGCTGAACGGTATTTCATGCGTCCGAGCATACGGCTGGTCGCACAAG
TACATGGATCGCAACCACGAGGCCCTCAACGTGTCGCAGAGGCCATTCTATCTGCTGTGGTGCATTCAGAGATGG
CTGACTCTCGTCTTGGACCTGCTGAATGCAGCAATTGCCATTCTTCTTGTCGGAGTTGCCACAAATGTCCGTGGG
GGGTCGAGTGCATTCCTTGGAGTCGCCTTGTTCAATGTCATAGCTCTCTCGTCATCCCTCCAGACTCTGATCACC
GAATGGACCCAGGTGGAGACCGCACTGGGAGCTATCAAGCGTATTCGATCTTACGTCACGACCACGGAGGATGAG
AACCTGCCAAGCGAAAATGGCACCGTTGCTGATGAATGGCCTCAAGAGGGAGAAATCACGTTCAAGGACATCTCG
GCCTCTTACGGGCCCTCTACTGAAGCAGTGCTGAAGGAAATCAGCTTCTCTATCAAGCCTGGCGAGAAGGTGGCC
ATCTGTGGCCGAACAGGCAGTGGCAAATCTTCACTGGTTGCAGCGCTGCTCAGAATGTTGGAGGTGGAAAACGGA
ACTATCTTGATAGATGGCGTAGATATCAGCACGATTCCCCGTCAAGAAGTGCGCAGTCGACTCAACACAGTGCCG
CAGGACCCTTTCTTCCTTCATGGCAGTGTTCGTCAGAATGTCGACCCCCTGGAGATGGCCGACGACGAACGCATT
AAGCAGGTGCTCCGTACCTTGAATCTCTGGGATATTTTCGAGAAGCAAGAGGGGCTCGATGAAGAAGTGACGCAG
GAAACGCTCTCCCACGGACAGCGACAACTGTTCTGCCTCGCCCGCAGTATGATCAAAAAGGGAAAGATTGTTGTC
ATGGATGAGGCAACAAGCAGCGTGGACGCTGAAACCGACGAACTCATGCAGCGAGTTCTCCGCGATGAGTTCAAT
GGGCGAACAGTCATCACCATCGCACACAAGCTTCATACCGTCCTGGATTACGATCGCGTGGTACTGCTTGACAAG
GGCAAGGTAGTCGAGACCGGCAACCCGCAAGAGCTGCTGCGAACAACCGACTCCGCGTTCCGTGAGCTCTACGAG
AAGCTCCGCAACAATGTCGAGTAA
Gene >Ophio5|4559
ATGTCGGGCACTCCCCCATGTTCCATTGCTGTCGAGGATCGGTTCGGCCCAGCCGTTACTGATTCCTGCCTCGGA
GGCTTCGACTTCACTCTTCTCTTCGAGGAGAGCATACTCACTCTTGTTCCCCTGGCGATCGCTTGTGCGTCTCAA
TGCTTGGCTCCTGGAAAATAGTTTGCTGACAATCATATCGCGCAGTGCTTTGGGCGGCGTCGCGAGCTCTCACCC
TCCGAATTGAGCCTGCCAAGGTTAAGGCATCATGGCTGCTCGCGGCGAAAATGGTATTCATTCACATCTTACTTC
ACCAACGTTCCATTGAATCCCGTGTCTGAGGCTGACGAGCGGTAGTTTCTGTACTTCAGCTACGTGATCCTACAA
GTCGCGCTTTTGGGTCTGTGGGTTGCGCGTGGCACGCCTCAAACGCGACTTACCGTGGCGTGCCTGGTCTTGACC
ATTGTCGGCTATGTCGCCCTCTCGCTCACGTCTTACATGGAGCACCTGCGCTCAGTCCGACCTTCGTCCATGCTG
TCCCTCTATCTTAGTATTTCGCTTCTCGTGGACATGGCTCGTGTCCGTACACTGTTCTTCATGCCTGATAGCAGA
ACGCTGGCCGGTATCTTGCTGGCCAGCCTTCTGCTCAAAGTCTTACTCTTCTGTCTGGAATCGACTGAGAAACGG
CACCTTCTGCGCGAGAACTGGAAAAGTGTGTCGCCAGAGGACACCGGTGGTTTTTACAATCGAGCTCTCTTTGTG
TGGTTGAACGCCGTTTTCCGCAAGGGTTTCCGCACTCTCTTGACAATCGCAACTCTGACTCCTCTGGACGACGAG
ATGCTGGAGGCTTCTAACCCGACCAAGTTGATCGAGCGGTGGGAAAAAGGTCATTCTCAAGCCATCGTAACTGAG
TTGGCGAAATGCTAACATTGTTTTCTTCGTCTAGCCGGCAAATCAAGCGAACATTCTTTGGCCTGGACCTTTGTG
GTGCACTACAAGTGGTGCATCTTCTCCGGCATCTTACCAAGATTGGCTTATACCGGTTTCAGTTTCTCACAGCCC
TACCTGATTCAGCGTGTTCTCGACTTTACCTCCGAGCCTGAAAATCCAAACTCGCGAAACATATCATATGGACTG
GTCGGGGCATATGCTATTGTTTATATTGGACTTTCTGTTCGCACTCCCGCTTTCCCTCCTGAGATACTCAGCTTA
TACCTCTCGCCAGTTATCGTTTGCCATATATCAACACAAGACGTACCGCCTGCTCACGCTGTTTCGCGGCAGCCT
GGTGACACTCATCTTCAACAAGACGCTTCGAGTCAGCTCAACGTCGATCGCAGACGGCGAGGCAATTACTCTCAT
GAGCGCCGACATAGATCGAGTCGGCTCCGTCACTCTCATTCACGAGTTCTATGCCAGCTTCATCGAGGCCGCGAT
AGCCCTCTGGCTTCTGTACAGCCTCCTCGGAATAGCCGTTGTGGCTCCCGTTCTCTGGATCATTGGTATGAACAG
TCATCAATCCTTCCAAGTACAGTTGATTGACTTGGTGCCAGTTTGTCTCATCGGGGGAATTCCTCTAGCCAGAGC
GGCTGGTAATGCTCAAACTCCCTGGCTCGAGGCTATCGAAGAGCGCCTCGCGGCAACGTCCAAGGCGCTAAATGC
CATGAAACCAATCAAGATGACCGGTTTGGCCGACATCGTGTCTTCTCAGATTGCCAATTTCAGGTTGTTGGAGAT
TCGCGCTTCTCTCCGCCATCGTGTCCTCAACATCTTCGTCTTTGTCGCGTGTAAGTAGCCTCAAACCGTTCTGTT
TGCATCCGCTGACTCTCGACCAGACTTCGCGTCCTCCGGCCTAGCCCCAGTGTGGGGGTTCGGCGTCTATATCCT
TCTCGCAAGATCTAGAAATAGCGGGACCTTGACCGAGAGCACTGCGTTTGCCGCCCTCAGTGCGTTCGAGCTCCT
GAACCAGCCCATGATGAATGCCATCGACGGATTTGAGCACGTTCAAACTGTCCTCAATTCCTTTCGGCGGATCCA
AGAGTACTTGGTTAGCGAGGAGCGGGAAGACTACAGAATTTCCAGCCTGGACAGGACGCCTTCGGACTCTGATCT
CTCCAGGTCTCAGGAAAACGAAAAGGTCGAAAAGCCCCGGATCAAGGACATGTCGGACGCCTGGCCAGACTCCAT
CAGGGACGATTCAATCACAGCCGCCGTCGTGAATGATGCCTCAGCCCAATACTCGGAGGAAGGCGAGCCAGTGCT
CCGAAACCTCAGCTTTGAAGTCCATCGCAGCCAGATAACGATGATCTACGGTCCGGTTGGCTCTGGAAAGTCGAC
GCTGCTGAAACTGCTACTGGGAGAAATGCCAATCACCTCTGGATCCGTCACCGCCAACTTTTCCAGAACAGCCTA
CTGCCCGCAGACGCCATGGATCACCTGGGGCAGCGTTCAGCAAAACATCGTCGGCATGTCCTCCTTCGACAATGC
TTGGTACGACACTGTAGTTCGTGCGTGCGCGCTACTCCCCGACTTTGAGGAGTTGACAAACGGAGACAAAACCCA
TGCCGGCATCAGAGGCGCTCGACTGAGCGGCGGGCAGCAAATGCGGGTGGTGCGTAGACACGCGCGTTGAGCTCA
ATGCTGTATGCTGATGATCCTCCAGTCCTTTGCTCGAGCACTTTACTCGAGAAATGCTACCATGATTCTGGACGA
CGTCCTTACAGGCCTGGATCGGGCCACTGAACGGACCATCTTAGACGCCGTGTTCAGTCCTCAAGGATTGTTGAG
ACAACAGAAATCCACGGTGGTTTGGACCACAAACTCAGGTAGGCCACCACAAAGCGAGGTTTGTTGAGAAGATAT
TACTTACTGACTTCAAACTCCAGCCCATCACCTGAGTTATGCCGACCATGTGATTTGTCTGGACAAAGATGGAAA
GATCGCGGAGCAAGGCCCCCTCGACAAACTGTCTATTGCTGCCAATGGCGTTCAGAGTCTTTCAAGCCAGCCAAT
CATGGAAACCAGTCGTCCAGAGCTAGAAATCCCCGAGGATGCTCTCCATGAGCTGGAGATCCTCGAAGAGCAGGA
GCCAGAAGAGACCCGCCGTGCAGGAGACATGCGAATTTACGCCTACTATGCAAAGACGGCAGGCTGGTGGACAAC
CTTGATCTATCTATTTGCCTGTGCCGCCTTTGTGTACGGCGCCATCTTTCCCTGTAAGGTGCCCCAGGACTTGAT
CTCACACGAGCAGCCCACACTGACCTGACTTCCCTCGGCCAGCTGTCTGGTTGCAGTGGTGGACAAATGCCAACG
CGGAGCGTCCAAACGAGCGTATTGGCTACTGGCTTGGTGTCTATGGCGTACTCGCGGCCGTGACCATGGTTGGCT
GCACGCTGGCTGACTGGTAAGACTGCCTTTGAGCTGCTGAATAAAGCCAACTCACAAGGTATTTAGTGTCTTCAA
CCTGGCCGTGCTTCCTACAACCGCACGAAGGTTCCATGAGCTCCTGTTGAGCACCACAATGCGGTAAGTCGACTT
CATGTCCAAAGAGGGGTTGACACTGACTTCACGCATTCAGGGCGCCGACGTCTTTTCTGACGTCCACGAATGCGG
GAACGACGCTGAACAGGTAAGGCTGACCTTCAGCTCCTTTGAAGGAACACAGCTAATTCGAATTACGTTGCAGGT
TCAGCCAAGATCTCGAACTAATTGACAATGACCTGCCCATGGCTATTGATCAGACCATATTCCAGTTCTTCTCAG
TAATCGCTTCAGCCGTCCTTGTCTTCATTGGCTCTGGCTATGTCGCCGCTGCCATTCCTTTTGTTTTCGTGGCGC
TGGCCGTCATTCAGTTTTACTATCTCCGCACATCCCGGCAGCTGCGACTCCTCGACATCGAAGCCAAGGCACCCC
TTTTGTCCCAGTTCCTGGAGACGCTGAACGGTATTTCATGCGTCCGAGCATACGGCTGGTCGCACAAGTACATGG
ATCGCAACCACGAGGCCCTCAACGTGTCGCAGAGGCCATTCTATCTGCTGTGGTGCATTCAGAGATGGCTGACTC
TCGTCTTGGACCTGCTGAATGCAGCAATTGCCATTCTTCTTGTCGGAGTTGCCACAAATGTCCGTGGGGGGTCGA
GTGCATTCCTTGGAGTCGCCTTGTTCAATGTCATAGCTCTCTCGTCATCCCTCCAGACTCTGATCACCGAATGGA
CCCAGGTGGAGACCGCACTGGGAGCTATCAAGCGTATTCGATCTTACGTCACGACCACGGAGGATGAGAACCTGC
CAAGCGAAAATGGCACCGTTGCTGATGAATGGCCTCAAGAGGGAGAAATCACGTTCAAGGACATCTCGGCCTCTT
ACGGGCCCTCTACTGAAGCAGTGCTGAAGGAAATCAGCTTCTCTATCAAGCCTGGCGAGAAGGTGGCCATCTGTG
GCCGAACAGGCAGGCAAGTTGACGCTGATACCACTCAGGTTGTTGATCGGACTAACAGCCTGCTAGTGGCAAATC
TTCACTGGTTGCAGCGCTGCTCAGAATGTTGGAGGTGGAAAACGGAACTATCTTGATAGATGGCGTAGATATCAG
CACGATTCCCCGTCAAGAAGTGCGCAGTCGACTCAACACAGTGCCGCAGGACCCTTTCTTCCTTCATGGCAGTGT
TCGTCAGAATGTCGACCCCCTGGAGATGGCCGACGACGAACGCATTAAGCAGGTGCTCCGTACCTTGAATCTCTG
GGATATTTTCGAGAAGCAAGAGGGGCTCGATGAAGAAGTGACGCAGGAAACGCTCTCCCACGGACAGCGACAACT
GTTCTGCCTCGCCCGCAGTATGATCAAAAAGGGAAAGATTGTTGTCATGGATGAGGCAACAAGCAGCGTGGACGC
TGAAACCGACGAACTCATGCAGCGAGTTCTCCGCGATGAGTTCAATGGGCGAACAGTCATCACCATCGCACACAA
GCTTCATACCGTCCTGGATTACGATCGCGTGGTACTGCTTGACAAGGGCAAGGTAGTCGAGACCGGCAACCCGCA
AGAGCTGCTGCGAACAACCGACTCCGCGTTCCGTGAGCTCTACGAGAAGCTCCGCAACAATGTCGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail