Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4552
Gene name
Locationscaffold_361:8825..9908
Strand-
Gene length (bp)1083
Transcript length (bp)978
Coding sequence length (bp)975
Protein length (aa) 325

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 2.6E-14 106 174

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6PG31|RNPS1_DANRE RNA-binding protein with serine-rich domain 1 OS=Danio rerio GN=rnps1 PE=2 SV=1 101 185 3.0E-14
sp|Q9SEE9|SR45_ARATH Serine/arginine-rich splicing factor SR45 OS=Arabidopsis thaliana GN=SR45 PE=1 SV=1 108 193 5.0E-14
sp|Q5XG24|RNP1A_XENLA RNA-binding protein with serine-rich domain 1-A OS=Xenopus laevis GN=rnps1-a PE=2 SV=1 90 181 2.0E-13
sp|Q3KPW1|RNP1B_XENLA RNA-binding protein with serine-rich domain 1-B OS=Xenopus laevis GN=rnps1-b PE=2 SV=1 90 181 2.0E-13
sp|Q28E41|RNPS1_XENTR RNA-binding protein with serine-rich domain 1 OS=Xenopus tropicalis GN=rnps1 PE=2 SV=1 90 181 2.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6PG31|RNPS1_DANRE RNA-binding protein with serine-rich domain 1 OS=Danio rerio GN=rnps1 PE=2 SV=1 101 185 3.0E-14
sp|Q9SEE9|SR45_ARATH Serine/arginine-rich splicing factor SR45 OS=Arabidopsis thaliana GN=SR45 PE=1 SV=1 108 193 5.0E-14
sp|Q5XG24|RNP1A_XENLA RNA-binding protein with serine-rich domain 1-A OS=Xenopus laevis GN=rnps1-a PE=2 SV=1 90 181 2.0E-13
sp|Q3KPW1|RNP1B_XENLA RNA-binding protein with serine-rich domain 1-B OS=Xenopus laevis GN=rnps1-b PE=2 SV=1 90 181 2.0E-13
sp|Q28E41|RNPS1_XENTR RNA-binding protein with serine-rich domain 1 OS=Xenopus tropicalis GN=rnps1 PE=2 SV=1 90 181 2.0E-13
sp|Q5NVM8|RNPS1_PONAB RNA-binding protein with serine-rich domain 1 OS=Pongo abelii GN=RNPS1 PE=2 SV=1 90 181 9.0E-13
sp|Q99M28|RNPS1_MOUSE RNA-binding protein with serine-rich domain 1 OS=Mus musculus GN=Rnps1 PE=2 SV=1 90 181 9.0E-13
sp|Q4R5N1|RNPS1_MACFA RNA-binding protein with serine-rich domain 1 OS=Macaca fascicularis GN=RNPS1 PE=2 SV=1 90 181 9.0E-13
sp|Q15287|RNPS1_HUMAN RNA-binding protein with serine-rich domain 1 OS=Homo sapiens GN=RNPS1 PE=1 SV=1 90 181 9.0E-13
sp|A6QR16|RNPS1_BOVIN RNA-binding protein with serine-rich domain 1 OS=Bos taurus GN=RNPS1 PE=2 SV=1 90 181 9.0E-13
sp|Q6AYK1|RNPS1_RAT RNA-binding protein with serine-rich domain 1 OS=Rattus norvegicus GN=Rnps1 PE=2 SV=1 90 181 1.0E-12
sp|Q1MTR2|RNPS1_SCHPO RNA-binding protein with serine-rich domain 1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC13G1.14c PE=3 SV=2 106 179 1.0E-10
sp|Q8LFS6|BRN1L_ARATH RNA-binding protein BRN1 OS=Arabidopsis thaliana GN=BRN1 PE=2 SV=1 105 259 5.0E-09
sp|Q9R0U0|SRS10_MOUSE Serine/arginine-rich splicing factor 10 OS=Mus musculus GN=Srsf10 PE=1 SV=2 101 199 2.0E-08
sp|O75494|SRS10_HUMAN Serine/arginine-rich splicing factor 10 OS=Homo sapiens GN=SRSF10 PE=1 SV=1 101 199 2.0E-08
sp|Q8WXF0|SRS12_HUMAN Serine/arginine-rich splicing factor 12 OS=Homo sapiens GN=SRSF12 PE=2 SV=1 101 180 3.0E-07
sp|Q6PFR5|TRA2A_MOUSE Transformer-2 protein homolog alpha OS=Mus musculus GN=Tra2a PE=1 SV=1 99 192 1.0E-06
sp|Q13595|TRA2A_HUMAN Transformer-2 protein homolog alpha OS=Homo sapiens GN=TRA2A PE=1 SV=1 99 192 1.0E-06
sp|Q54WM4|EIF3G_DICDI Eukaryotic translation initiation factor 3 subunit G OS=Dictyostelium discoideum GN=eif3G PE=3 SV=1 56 169 2.0E-06
sp|Q9PTX2|CIRBP_LITCT Cold-inducible RNA-binding protein OS=Lithobates catesbeiana GN=cirbp PE=2 SV=1 105 177 2.0E-06
sp|P19018|TRA2_DROME Transformer-2 sex-determining protein OS=Drosophila melanogaster GN=tra2 PE=1 SV=1 83 190 2.0E-06
sp|Q5R723|PPIE_PONAB Peptidyl-prolyl cis-trans isomerase E OS=Pongo abelii GN=PPIE PE=2 SV=1 111 185 3.0E-06
sp|Q9UNP9|PPIE_HUMAN Peptidyl-prolyl cis-trans isomerase E OS=Homo sapiens GN=PPIE PE=1 SV=1 111 185 3.0E-06
sp|A4FV72|PPIE_BOVIN Peptidyl-prolyl cis-trans isomerase E OS=Bos taurus GN=PPIE PE=2 SV=1 111 185 4.0E-06
sp|Q9QZH3|PPIE_MOUSE Peptidyl-prolyl cis-trans isomerase E OS=Mus musculus GN=Ppie PE=1 SV=2 106 185 4.0E-06
sp|Q91VM5|RMXL1_MOUSE RNA binding motif protein, X-linked-like-1 OS=Mus musculus GN=Rbmxl1 PE=2 SV=1 105 177 5.0E-06
sp|Q4V898|RBMX_RAT RNA-binding motif protein, X chromosome OS=Rattus norvegicus GN=Rbmx PE=1 SV=1 105 177 6.0E-06
sp|Q9V3G3|PPIE_DROME Peptidyl-prolyl cis-trans isomerase E OS=Drosophila melanogaster GN=cyp33 PE=1 SV=1 106 185 7.0E-06
sp|Q9WV02|RBMX_MOUSE RNA-binding motif protein, X chromosome OS=Mus musculus GN=Rbmx PE=1 SV=1 105 177 7.0E-06
sp|Q4R7F0|RBMX_MACFA RNA-binding motif protein, X chromosome OS=Macaca fascicularis GN=RBMX PE=2 SV=1 105 177 8.0E-06
sp|A5A6M3|RBMX_PANTR RNA-binding motif protein, X chromosome OS=Pan troglodytes GN=RBMX PE=2 SV=1 105 177 8.0E-06
sp|P38159|RBMX_HUMAN RNA-binding motif protein, X chromosome OS=Homo sapiens GN=RBMX PE=1 SV=3 105 177 8.0E-06
sp|O35698|RBY1A_MOUSE RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Mus musculus GN=Rbmy1a1 PE=1 SV=2 105 177 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4552
MNGEKSRRFFPLLSIAISSLLSLLCSAMASRSPPRGHYRSLTRSPSPQPLEARSSARRRRFDSRSPSRSPTPPQR
RPRAASRSWSRGRARDSREPSDVSPPSGTKIVVERLSKNVREAHLREIFGHYGPIQDLDLPINRAFGTNRGTAYI
LYEHREDAEEAIANMHEGHIDGATVNVSIVLPRRIFSPEPPLARRGANIDPRNSVSGPRGGRGYRGHPATVGHRR
PSSPGRYGPRSNAYPPPSRSRSRSPYRSPPRLPRGSRGGGRSFDSYSSRSRSKSPPPRRGGAAGGGRFASDGFRR
RSRSRSAGSYAGRNRSPSPPRQSYW
Coding >Ophio5|4552
ATGAATGGAGAAAAATCACGACGCTTCTTTCCTCTCCTCTCCATCGCCATCTCTTCTCTGCTCTCCCTCCTCTGC
TCTGCCATGGCTTCGCGCTCGCCGCCGCGCGGTCACTACCGCTCTCTGACGCGCTCGCCTTCGCCTCAGCCCTTG
GAAGCCCGCTCGTCAGCCCGCCGTCGTCGCTTCGATTCGCGTTCGCCGTCGCGCTCGCCTACGCCGCCTCAGCGT
CGTCCTAGAGCTGCCAGCCGCAGTTGGAGCCGTGGTAGGGCGAGAGACAGTCGTGAGCCTAGCGATGTCTCGCCT
CCATCCGGAACCAAGATCGTGGTGGAGCGGCTGTCGAAAAACGTTCGGGAGGCCCATCTTCGCGAGATATTTGGC
CATTACGGCCCGATTCAGGACCTCGATCTTCCTATAAACAGGGCTTTCGGCACGAATCGTGGGACCGCCTACATC
CTGTACGAGCATCGCGAGGACGCCGAGGAGGCCATCGCCAACATGCATGAGGGCCACATCGACGGCGCTACTGTC
AACGTCTCCATCGTCCTGCCGCGACGCATCTTCTCGCCCGAACCGCCATTGGCCCGACGAGGTGCCAACATCGAT
CCCCGCAATTCAGTTTCCGGTCCTCGCGGCGGGCGTGGATACCGCGGCCATCCTGCGACTGTTGGTCACCGTCGC
CCCTCGTCCCCCGGCCGTTACGGGCCCCGATCCAACGCGTATCCGCCACCGTCGCGGTCGCGGTCCCGCTCGCCG
TATAGGTCGCCCCCTAGGCTCCCTCGGGGTTCCCGCGGTGGTGGCCGCTCCTTCGACTCGTACTCGTCTCGGTCG
AGATCCAAGTCGCCTCCTCCGCGACGAGGCGGAGCAGCAGGCGGCGGACGGTTTGCCAGCGATGGCTTCCGTCGC
CGCAGTCGCAGTCGGAGCGCGGGCAGCTACGCAGGCCGGAATCGCTCTCCTAGCCCTCCTAGGCAGAGCTATTGG
Transcript >Ophio5|4552
ATGAATGGAGAAAAATCACGACGCTTCTTTCCTCTCCTCTCCATCGCCATCTCTTCTCTGCTCTCCCTCCTCTGC
TCTGCCATGGCTTCGCGCTCGCCGCCGCGCGGTCACTACCGCTCTCTGACGCGCTCGCCTTCGCCTCAGCCCTTG
GAAGCCCGCTCGTCAGCCCGCCGTCGTCGCTTCGATTCGCGTTCGCCGTCGCGCTCGCCTACGCCGCCTCAGCGT
CGTCCTAGAGCTGCCAGCCGCAGTTGGAGCCGTGGTAGGGCGAGAGACAGTCGTGAGCCTAGCGATGTCTCGCCT
CCATCCGGAACCAAGATCGTGGTGGAGCGGCTGTCGAAAAACGTTCGGGAGGCCCATCTTCGCGAGATATTTGGC
CATTACGGCCCGATTCAGGACCTCGATCTTCCTATAAACAGGGCTTTCGGCACGAATCGTGGGACCGCCTACATC
CTGTACGAGCATCGCGAGGACGCCGAGGAGGCCATCGCCAACATGCATGAGGGCCACATCGACGGCGCTACTGTC
AACGTCTCCATCGTCCTGCCGCGACGCATCTTCTCGCCCGAACCGCCATTGGCCCGACGAGGTGCCAACATCGAT
CCCCGCAATTCAGTTTCCGGTCCTCGCGGCGGGCGTGGATACCGCGGCCATCCTGCGACTGTTGGTCACCGTCGC
CCCTCGTCCCCCGGCCGTTACGGGCCCCGATCCAACGCGTATCCGCCACCGTCGCGGTCGCGGTCCCGCTCGCCG
TATAGGTCGCCCCCTAGGCTCCCTCGGGGTTCCCGCGGTGGTGGCCGCTCCTTCGACTCGTACTCGTCTCGGTCG
AGATCCAAGTCGCCTCCTCCGCGACGAGGCGGAGCAGCAGGCGGCGGACGGTTTGCCAGCGATGGCTTCCGTCGC
CGCAGTCGCAGTCGGAGCGCGGGCAGCTACGCAGGCCGGAATCGCTCTCCTAGCCCTCCTAGGCAGAGCTATTGG
TGA
Gene >Ophio5|4552
ATGAATGGAGAAAAATCACGACGCTTCTTTCCTCTCCTCTCCATCGCCATCTCTTCTCTGCTCTCCCTCCTCTGC
TCTGCCATGGCTTCGCGCTCGCCGCCGCGCGGTCACTACCGCTCTCTGACGCGCTCGCCTTCGCCTCAGCCCTTG
GAAGCCCGCTCGTCAGCCCGCCGTCGTCGCTTCGATTCGCGTTCGCCGTCGCGCTCGCCTACGCCGCCTCAGCGT
CGTCCTAGAGCTGCCAGCCGCAGTTGGAGCCGTGGTAGGGCGAGAGACAGTCGTGAGCCTAGCGATGTCTCGCCT
CCATCCGGAACCAAGGTTCATTTTACCGCCCTTTTGCTCGTCTGGTTATCCGTCGCTCACTGGGCTAGATCGTGG
TGGAGCGGCTGTCGAAAAACGTTCGGGAGGCCCATCTTCGCGAGATATTTGGCCATTACGGCCCGATTCAGGACC
TCGATCTTCCTATAAACAGGGCTTGTGAGCTACCTTCTCCCAGAGTCTACCCGGTGACTGAAACTGACGTTGCTA
GTCGGCACGAATCGTGGGACCGCCTACATCCTGTACGAGCATCGCGAGGACGCCGAGGAGGCCATCGCCAACATG
CATGAGGGCCACATCGACGGCGCTACTGTCAACGTCTCCATCGTCCTGCCGCGACGCATCTTCTCGCCCGAACCG
CCATTGGCCCGACGAGGTGCCAACATCGATCCCCGCAATTCAGTTTCCGGTCCTCGCGGCGGGCGTGGATACCGC
GGCCATCCTGCGACTGTTGGTCACCGTCGCCCCTCGTCCCCCGGCCGTTACGGGCCCCGATCCAACGCGTATCCG
CCACCGTCGCGGTCGCGGTCCCGCTCGCCGTATAGGTCGCCCCCTAGGCTCCCTCGGGGTTCCCGCGGTGGTGGC
CGCTCCTTCGACTCGTACTCGTCTCGGTCGAGATCCAAGTCGCCTCCTCCGCGACGAGGCGGAGCAGCAGGCGGC
GGACGGTTTGCCAGCGATGGCTTCCGTCGCCGCAGTCGCAGTCGGAGCGCGGGCAGCTACGCAGGCCGGAATCGC
TCTCCTAGCCCTCCTAGGCAGAGCTATTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail