Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4547
Gene name
Locationscaffold_360:9260..11039
Strand+
Gene length (bp)1779
Transcript length (bp)1659
Coding sequence length (bp)1656
Protein length (aa) 552

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10281 Ish1 Putative nuclear envelope organisation protein 5.8E-13 131 165
PF10281 Ish1 Putative nuclear envelope organisation protein 2.3E-12 186 221
PF10281 Ish1 Putative nuclear envelope organisation protein 1.2E-06 336 369
PF10281 Ish1 Putative nuclear envelope organisation protein 1.8E-11 454 489

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7X6|ISH1_SCHPO Stress response protein ish1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ish1 PE=1 SV=1 8 496 1.0E-23
sp|Q03104|MSC1_YEAST Meiotic sister chromatid recombination protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSC1 PE=1 SV=1 126 497 1.0E-23
sp|O94559|YF65_SCHPO Uncharacterized protein C23C4.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23C4.05c PE=3 SV=1 132 496 4.0E-14
sp|O94559|YF65_SCHPO Uncharacterized protein C23C4.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23C4.05c PE=3 SV=1 73 279 4.0E-11

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4547
MRLNAFLLGAAVAVTGTLASSWFPGTKAAYNKWHETELERWLSDHDIPYPTPADRADLESLVDKNWNDYVVEPYN
SWDTASLNNYIQAKGKEASDGAAETRDALVSQVKSNWAHTEDNARHAYANVKEWIFDSWTESQLKAFCDRNGIPV
PQPRTRDSLLQKARSGYETAAKKAGETAAYPGSWLYKSWAESDLKSWLDSNGFPAPQPSSRDKLIASVRRNSRLA
FLKAQAESARASERARATYTTLTDTIIDAWGESQLKEFCDKNDISVPQGTRVNELRALVRKRRAEILGEGVGASA
ASAFGAATSRAGNEYAKASDGAAAAAEDAFNYAAGTWSESRIKAYLDARGVPIPQHSNVDALRALARKHAHKAAG
GWGAWTLDDFSRENLKHYLMQHGDSAAKAVAEQKDASRDALVSAAHSVYSSASSAGGATFASVTSAIASATAAAK
QSTFDAWTDTDLKAYLDSYGVPVPQGSNLEQLKALARKHSTYFRYGTSTPSETLFAKIGDTARQGWNWVAQQLDL
GSQAAQQKAAEAGSAAKAKVSEAREEL
Coding >Ophio5|4547
ATGAGGCTGAACGCCTTCCTTCTGGGGGCTGCCGTGGCTGTCACGGGCACGCTCGCCAGTAGCTGGTTCCCCGGC
ACCAAGGCTGCCTATAACAAGTGGCACGAGACGGAGCTCGAGCGTTGGCTGTCTGACCATGATATTCCGTACCCG
ACTCCCGCCGACCGTGCCGATCTGGAGAGCCTGGTCGACAAGAACTGGAATGACTATGTCGTTGAGCCTTACAAC
AGCTGGGATACTGCATCACTAAATAACTACATCCAAGCCAAGGGTAAAGAGGCGAGTGACGGGGCCGCAGAGACC
AGGGACGCTCTCGTTTCTCAGGTTAAGTCCAACTGGGCCCACACAGAGGACAACGCTCGCCATGCCTATGCCAAT
GTCAAAGAGTGGATTTTCGACAGCTGGACCGAGAGCCAGCTCAAGGCCTTTTGTGACAGGAACGGCATTCCGGTG
CCTCAACCTCGCACGCGCGACTCACTTCTTCAAAAGGCTCGTTCTGGCTACGAAACGGCAGCCAAGAAGGCCGGC
GAGACTGCCGCTTACCCGGGCAGCTGGCTCTACAAGTCTTGGGCTGAGTCTGATCTGAAGTCATGGCTCGACAGC
AACGGATTCCCTGCGCCTCAGCCCTCGTCTCGCGACAAGCTCATCGCCTCGGTCCGTCGGAATTCCCGGCTCGCC
TTCCTCAAGGCTCAGGCAGAGTCTGCGAGGGCCAGTGAGCGTGCCCGCGCTACATACACGACGCTGACGGACACC
ATCATCGACGCCTGGGGCGAGTCTCAACTCAAGGAGTTTTGTGACAAGAACGACATATCTGTTCCTCAGGGCACG
AGGGTCAACGAACTACGCGCGCTTGTTCGCAAACGTCGAGCCGAGATTCTTGGCGAGGGCGTCGGCGCCAGTGCA
GCATCAGCCTTTGGTGCCGCCACCTCGAGAGCTGGAAATGAGTATGCCAAGGCGTCGGATGGAGCGGCGGCGGCG
GCCGAAGATGCCTTCAACTATGCTGCGGGGACTTGGTCTGAGAGCCGAATCAAGGCCTATCTCGATGCTCGTGGA
GTTCCTATTCCTCAGCACTCCAATGTGGACGCTCTTCGAGCGCTCGCTCGGAAGCATGCACACAAGGCCGCTGGA
GGCTGGGGCGCTTGGACCTTGGATGACTTCTCCCGCGAGAATCTGAAGCACTACCTGATGCAGCATGGTGACAGC
GCAGCCAAGGCGGTGGCCGAGCAGAAGGACGCATCGCGCGACGCCCTCGTGAGTGCTGCGCACTCGGTCTATTCT
TCCGCTTCCTCCGCGGGCGGCGCGACTTTTGCTTCTGTCACCAGCGCCATAGCATCCGCCACGGCTGCCGCCAAA
CAATCTACCTTTGATGCCTGGACAGACACGGACCTGAAGGCCTATCTCGACAGCTATGGCGTTCCAGTTCCTCAG
GGCTCAAATCTCGAGCAGTTAAAGGCCCTGGCTCGCAAGCACTCGACGTACTTCCGATACGGCACCTCGACTCCG
AGCGAGACGCTCTTCGCTAAGATTGGGGACACGGCTCGTCAAGGCTGGAACTGGGTTGCCCAACAGCTCGACCTG
GGCAGCCAGGCAGCCCAGCAAAAGGCAGCCGAGGCCGGATCGGCTGCCAAGGCCAAGGTGTCGGAGGCTCGGGAA
GAGCTT
Transcript >Ophio5|4547
ATGAGGCTGAACGCCTTCCTTCTGGGGGCTGCCGTGGCTGTCACGGGCACGCTCGCCAGTAGCTGGTTCCCCGGC
ACCAAGGCTGCCTATAACAAGTGGCACGAGACGGAGCTCGAGCGTTGGCTGTCTGACCATGATATTCCGTACCCG
ACTCCCGCCGACCGTGCCGATCTGGAGAGCCTGGTCGACAAGAACTGGAATGACTATGTCGTTGAGCCTTACAAC
AGCTGGGATACTGCATCACTAAATAACTACATCCAAGCCAAGGGTAAAGAGGCGAGTGACGGGGCCGCAGAGACC
AGGGACGCTCTCGTTTCTCAGGTTAAGTCCAACTGGGCCCACACAGAGGACAACGCTCGCCATGCCTATGCCAAT
GTCAAAGAGTGGATTTTCGACAGCTGGACCGAGAGCCAGCTCAAGGCCTTTTGTGACAGGAACGGCATTCCGGTG
CCTCAACCTCGCACGCGCGACTCACTTCTTCAAAAGGCTCGTTCTGGCTACGAAACGGCAGCCAAGAAGGCCGGC
GAGACTGCCGCTTACCCGGGCAGCTGGCTCTACAAGTCTTGGGCTGAGTCTGATCTGAAGTCATGGCTCGACAGC
AACGGATTCCCTGCGCCTCAGCCCTCGTCTCGCGACAAGCTCATCGCCTCGGTCCGTCGGAATTCCCGGCTCGCC
TTCCTCAAGGCTCAGGCAGAGTCTGCGAGGGCCAGTGAGCGTGCCCGCGCTACATACACGACGCTGACGGACACC
ATCATCGACGCCTGGGGCGAGTCTCAACTCAAGGAGTTTTGTGACAAGAACGACATATCTGTTCCTCAGGGCACG
AGGGTCAACGAACTACGCGCGCTTGTTCGCAAACGTCGAGCCGAGATTCTTGGCGAGGGCGTCGGCGCCAGTGCA
GCATCAGCCTTTGGTGCCGCCACCTCGAGAGCTGGAAATGAGTATGCCAAGGCGTCGGATGGAGCGGCGGCGGCG
GCCGAAGATGCCTTCAACTATGCTGCGGGGACTTGGTCTGAGAGCCGAATCAAGGCCTATCTCGATGCTCGTGGA
GTTCCTATTCCTCAGCACTCCAATGTGGACGCTCTTCGAGCGCTCGCTCGGAAGCATGCACACAAGGCCGCTGGA
GGCTGGGGCGCTTGGACCTTGGATGACTTCTCCCGCGAGAATCTGAAGCACTACCTGATGCAGCATGGTGACAGC
GCAGCCAAGGCGGTGGCCGAGCAGAAGGACGCATCGCGCGACGCCCTCGTGAGTGCTGCGCACTCGGTCTATTCT
TCCGCTTCCTCCGCGGGCGGCGCGACTTTTGCTTCTGTCACCAGCGCCATAGCATCCGCCACGGCTGCCGCCAAA
CAATCTACCTTTGATGCCTGGACAGACACGGACCTGAAGGCCTATCTCGACAGCTATGGCGTTCCAGTTCCTCAG
GGCTCAAATCTCGAGCAGTTAAAGGCCCTGGCTCGCAAGCACTCGACGTACTTCCGATACGGCACCTCGACTCCG
AGCGAGACGCTCTTCGCTAAGATTGGGGACACGGCTCGTCAAGGCTGGAACTGGGTTGCCCAACAGCTCGACCTG
GGCAGCCAGGCAGCCCAGCAAAAGGCAGCCGAGGCCGGATCGGCTGCCAAGGCCAAGGTGTCGGAGGCTCGGGAA
GAGCTTTGA
Gene >Ophio5|4547
ATGAGGCTGAACGCCTTCCTTCTGGGGGCTGCCGTGGCTGTCACGGGCACGCTCGCCAGTAGCTGGTTCCCCGGC
ACCAAGGCTGGTAGGTGCCCGACATCTTTTCCGTGTCGTCTTCCAGCTCCTGATGTTGACCTTCGCCTCCAAGCC
TATAACAAGTGGCACGAGACGGAGCTCGAGCGTTGGCTGTCTGACCATGATATTCCGTACCCGACTCCCGCCGAC
CGTGCCGATCTGGAGAGCCTGGTCGACAAGAACTGGAATGACTATGTCGTTGAGCCTTACAACAGCTGGGATACT
GCATCACTAAATAACTACATCCAAGCCAAGGGTAAAGAGGCGAGTGACGGGGCCGCAGAGACCAGGGACGCTCTC
GTTTCTCAGGTTAAGTCCAACTGGGCCCACACAGAGGACAACGCTCGCCATGCCTATGCCAATGTCAAAGAGTGG
ATTTTCGACAGCTGGACCGAGAGCCAGCTCAAGGCCTTTTGTGACAGGAACGGCATTCCGGGTATGTGTCTGTCT
TTGTCTTCTCATCTTCATGCATGCTGACTGCCCCTCCCTTCAGTGCCTCAACCTCGCACGCGCGACTCACTTCTT
CAAAAGGCTCGTTCTGGCTACGAAACGGCAGCCAAGAAGGCCGGCGAGACTGCCGCTTACCCGGGCAGCTGGCTC
TACAAGTCTTGGGCTGAGTCTGATCTGAAGTCATGGCTCGACAGCAACGGATTCCCTGCGCCTCAGCCCTCGTCT
CGCGACAAGCTCATCGCCTCGGTCCGTCGGAATTCCCGGCTCGCCTTCCTCAAGGCTCAGGCAGAGTCTGCGAGG
GCCAGTGAGCGTGCCCGCGCTACATACACGACGCTGACGGACACCATCATCGACGCCTGGGGCGAGTCTCAACTC
AAGGAGTTTTGTGACAAGAACGACATATCTGTTCCTCAGGGCACGAGGGTCAACGAACTACGCGCGCTTGTTCGC
AAACGTCGAGCCGAGATTCTTGGCGAGGGCGTCGGCGCCAGTGCAGCATCAGCCTTTGGTGCCGCCACCTCGAGA
GCTGGAAATGAGTATGCCAAGGCGTCGGATGGAGCGGCGGCGGCGGCCGAAGATGCCTTCAACTATGCTGCGGGG
ACTTGGTCTGAGAGCCGAATCAAGGCCTATCTCGATGCTCGTGGAGTTCCTATTCCTCAGCACTCCAATGTGGAC
GCTCTTCGAGCGCTCGCTCGGAAGCATGCACACAAGGCCGCTGGAGGCTGGGGCGCTTGGACCTTGGATGACTTC
TCCCGCGAGAATCTGAAGCACTACCTGATGCAGCATGGTGACAGCGCAGCCAAGGCGGTGGCCGAGCAGAAGGAC
GCATCGCGCGACGCCCTCGTGAGTGCTGCGCACTCGGTCTATTCTTCCGCTTCCTCCGCGGGCGGCGCGACTTTT
GCTTCTGTCACCAGCGCCATAGCATCCGCCACGGCTGCCGCCAAACAATCTACCTTTGATGCCTGGACAGACACG
GACCTGAAGGCCTATCTCGACAGCTATGGCGTTCCAGTTCCTCAGGGCTCAAATCTCGAGCAGTTAAAGGCCCTG
GCTCGCAAGCACTCGACGTACTTCCGATACGGCACCTCGACTCCGAGCGAGACGCTCTTCGCTAAGATTGGGGAC
ACGGCTCGTCAAGGCTGGAACTGGGTTGCCCAACAGCTCGACCTGGGCAGCCAGGCAGCCCAGCAAAAGGCAGCC
GAGGCCGGATCGGCTGCCAAGGCCAAGGTGTCGGAGGCTCGGGAAGAGCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail