Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4544
Gene name
Locationscaffold_360:3415..4069
Strand-
Gene length (bp)654
Transcript length (bp)576
Coding sequence length (bp)573
Protein length (aa) 191

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q58838|Y1443_METJA UPF0132 membrane protein MJ1443 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1443 PE=3 SV=1 83 186 4.0E-09
sp|Q58922|Y1527_METJA UPF0132 membrane protein MJ1527 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1527 PE=3 SV=1 84 186 4.0E-06
sp|O30131|Y105_ARCFU UPF0132 membrane protein AF_0105 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_0105 PE=3 SV=1 88 186 5.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 59 0.45

Transmembrane Domains

Domain # Start End Length
1 94 111 17
2 118 140 22
3 144 166 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4544
MDFAPYQSSPPEHSRVGSPESISSPRPSHDALAASRKSPPLLQHPQPQRGWGGDLDGQAAAAAGGGGWTSAAAPS
GNHVSEFDTSLGLRLDYEACLAYLALPPLGAILLLILERNSDYVRFHAWQSALLFTALLVLHILISWSSLLSWLL
FFADVALVALLTLRAYRDAEILDRFEVPFFGTIASRILDDE
Coding >Ophio5|4544
ATGGACTTTGCCCCCTACCAATCGTCGCCCCCGGAGCACTCGCGCGTCGGATCTCCCGAATCCATCTCGTCGCCT
CGCCCTTCGCACGACGCCCTCGCCGCCAGCCGCAAGAGTCCGCCACTACTGCAGCACCCGCAACCTCAGCGCGGC
TGGGGAGGCGACTTGGACGGTCAGGCCGCTGCTGCTGCTGGCGGCGGCGGCTGGACCAGCGCCGCTGCCCCGTCT
GGTAACCACGTGAGCGAGTTCGACACCAGTCTCGGCCTGCGCCTCGACTACGAGGCTTGTCTGGCTTATCTTGCC
CTGCCGCCGCTGGGCGCCATCCTTCTCCTGATCCTAGAACGCAATAGCGACTACGTCCGTTTTCACGCCTGGCAG
TCGGCTCTGCTCTTCACCGCGCTTCTGGTCCTGCATATCCTCATCTCGTGGTCTTCGCTACTCAGCTGGCTTCTG
TTCTTCGCCGACGTCGCCCTTGTCGCCCTGCTCACCCTTAGGGCATACCGGGATGCCGAGATTCTCGACCGGTTC
GAGGTCCCCTTTTTCGGCACCATCGCTAGCCGCATCCTAGATGACGAG
Transcript >Ophio5|4544
ATGGACTTTGCCCCCTACCAATCGTCGCCCCCGGAGCACTCGCGCGTCGGATCTCCCGAATCCATCTCGTCGCCT
CGCCCTTCGCACGACGCCCTCGCCGCCAGCCGCAAGAGTCCGCCACTACTGCAGCACCCGCAACCTCAGCGCGGC
TGGGGAGGCGACTTGGACGGTCAGGCCGCTGCTGCTGCTGGCGGCGGCGGCTGGACCAGCGCCGCTGCCCCGTCT
GGTAACCACGTGAGCGAGTTCGACACCAGTCTCGGCCTGCGCCTCGACTACGAGGCTTGTCTGGCTTATCTTGCC
CTGCCGCCGCTGGGCGCCATCCTTCTCCTGATCCTAGAACGCAATAGCGACTACGTCCGTTTTCACGCCTGGCAG
TCGGCTCTGCTCTTCACCGCGCTTCTGGTCCTGCATATCCTCATCTCGTGGTCTTCGCTACTCAGCTGGCTTCTG
TTCTTCGCCGACGTCGCCCTTGTCGCCCTGCTCACCCTTAGGGCATACCGGGATGCCGAGATTCTCGACCGGTTC
GAGGTCCCCTTTTTCGGCACCATCGCTAGCCGCATCCTAGATGACGAGTAG
Gene >Ophio5|4544
ATGGACTTTGCCCCCTACCAATCGTCGCCCCCGGAGCACTCGCGCGTCGGATCTCCCGAATCCATCTCGTCGCCT
CGCCCTTCGCACGACGCCCTCGCCGCCAGCCGCAAGAGTCCGCCACTACTGCAGCACCCGCAACCTCAGCGCGGC
TGGGGAGGCGACTTGGACGGTCAGGCCGCTGCTGCTGCTGGCGGCGGCGGCTGGACCAGCGCCGCTGCCCCGTCT
GGTAACCACGTGAGCGAGTTCGACACCAGTCTCGGCCTGCGCCTCGACTACGAGGCTTGTCTGGCTTATCTTGCC
CTGCCGCCGCTGGGCGCCATCCTTCTCCTGATCCTAGAACGCAATAGCGACTACGTCCGTTTTCACGCCTGGCAG
TCGGCTCTGCTCTTCACCGCGCTTCTGGTCCTGCATATCCTCATCTCGTGGTCTTCGCTACTCAGCTGGCTTCTG
TTCTTCGCCGACGTCGCCCTTGTCGCCCTGCTCACCCTTAGGGCATACCGGGATGCCGAGATTCTCGACCGGTGC
CGTCCTCCCCCCCCCCCTTTCTTGCTCGTCGTGCGCTGCTGGTGTCGCTTAGAGATAGCTAACGCCACACCTAGG
TTCGAGGTCCCCTTTTTCGGCACCATCGCTAGCCGCATCCTAGATGACGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail