Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4543
Gene name
Locationscaffold_360:593..3223
Strand+
Gene length (bp)2630
Transcript length (bp)2493
Coding sequence length (bp)2490
Protein length (aa) 830

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09511 RNA_lig_T4_1 RNA ligase 2.9E-87 112 344
PF08302 tRNA_lig_CPD Fungal tRNA ligase phosphodiesterase domain 3.7E-66 602 827
PF08303 tRNA_lig_kinase tRNA ligase kinase domain 8.2E-49 442 599

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P09880|TRNL_YEAST tRNA ligase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRL1 PE=1 SV=1 63 798 2.0E-159
sp|Q10313|TRNL_SCHPO tRNA ligase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trl1 PE=3 SV=2 78 798 3.0E-159
sp|P43075|TRNL_CANAL tRNA ligase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LIG1 PE=3 SV=2 87 802 3.0E-127

GO

GO Term Description Terminal node
GO:0003972 RNA ligase (ATP) activity Yes
GO:0006388 tRNA splicing, via endonucleolytic cleavage and ligation Yes
GO:0005524 ATP binding Yes
GO:0006139 nucleobase-containing compound metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0009987 cellular process No
GO:0043170 macromolecule metabolic process No
GO:0005488 binding No
GO:0071704 organic substance metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0043167 ion binding No
GO:0017076 purine nucleotide binding No
GO:0046483 heterocycle metabolic process No
GO:0008033 tRNA processing No
GO:0090304 nucleic acid metabolic process No
GO:0044238 primary metabolic process No
GO:0008380 RNA splicing No
GO:0043168 anion binding No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:1901360 organic cyclic compound metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:1901265 nucleoside phosphate binding No
GO:0008452 RNA ligase activity No
GO:0006399 tRNA metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0000394 RNA splicing, via endonucleolytic cleavage and ligation No
GO:0003824 catalytic activity No
GO:0034660 ncRNA metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0034470 ncRNA processing No
GO:0036094 small molecule binding No
GO:0097159 organic cyclic compound binding No
GO:0097367 carbohydrate derivative binding No
GO:0006396 RNA processing No
GO:0016070 RNA metabolic process No
GO:0000166 nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0016874 ligase activity No
GO:0016886 ligase activity, forming phosphoric ester bonds No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4543
MNVVSRSAQRLLSLRHCRVVPSMAAPPPTTHLATQHIPGQVQSLATVAPQANEESLAPVMEFLENGLKKKNKFAI
LSRKTTFDVKSSRDGIKLDSWRLREHDYKRQWLPTYARGLFTTKRKDGTPEIAVRGYDKFFNIGEVRHTKWENII
TQTKPPYDLTLKENGCIIFFAGLEDGTLVVCSKHSTGDRPNCVSHANAGEALLEKQLAAIGKTKEEFARELRERN
ATAVAELCDDSFEEHILAYEPEKAGLYLHGINHNLPIFSTYASSDVQDFADQWGFRKIGFITMNDVKSVKAFLEE
TARTGAYEGRDIEGFVIRCKMSTEPEVKPYQDWFFKFKFDEPYLMYRQWREVTKMMISGKEPTYKRHKLITGKYL
EFARKRLAADPELGRRYLENHGIIALRNDFLRAENLKGSEAADMDEPAGVKDKPKVEIMSDVTGNVILCPVATIG
CGKTTCAMALSQLFGWGHVQNDNIAGRNRPPRFTRAVLEGLKGRPAVFADRNNTEKRERLQLLRDLKEKNGQVKV
VCLHYVHDEANMDNIRQLTTQRVKLRGDNHQTIKAARDPEKQETIMGGFLGRYEPCEPWSHPDSGFDLVIDLDPL
ADSRVNLETIVTQLHKYFPHLMNLPSSEQLDSAIKHALEHKIPQSEPMRQKKGRDYWVHNLHYMSVNVESKAVNE
ALQQAFEAADEQTSGFFKKLKLTGRVQKDFHVTLIHRSSSKDYPELWQRYMNALEPVEGDDGKIGECSVVLERIV
FDDRIMAIVVRLVDEEGKWECVNRVAHITVGTRDASIKAKESNDLLAKWLDGGVKKGLMQELVFEQKPTIAGNVG
AVRLR
Coding >Ophio5|4543
ATGAACGTCGTATCAAGGTCTGCGCAAAGACTGCTTTCACTGCGTCACTGTCGCGTCGTTCCAAGCATGGCGGCG
CCGCCGCCCACAACTCACCTTGCCACTCAACACATTCCCGGGCAAGTCCAGTCTCTGGCCACTGTCGCTCCACAA
GCCAATGAAGAAAGCTTGGCCCCTGTTATGGAGTTCCTTGAAAACGGTCTCAAGAAGAAGAATAAGTTCGCTATT
TTATCACGTAAGACAACTTTCGACGTCAAATCATCTCGTGACGGCATCAAGCTCGACTCATGGAGGCTTCGCGAG
CACGATTACAAGAGGCAGTGGTTACCCACTTACGCCCGAGGACTCTTTACAACCAAGAGGAAAGACGGCACCCCT
GAGATCGCTGTTAGGGGTTACGATAAGTTCTTCAACATTGGTGAGGTCAGACATACCAAGTGGGAAAATATCATT
ACCCAGACGAAGCCGCCGTACGACCTGACTCTCAAGGAAAACGGCTGCATCATCTTCTTTGCTGGCCTCGAGGAC
GGAACACTTGTCGTTTGCAGCAAGCACTCGACCGGCGACCGACCCAACTGCGTGAGCCATGCTAATGCTGGCGAG
GCTCTCTTGGAGAAACAACTGGCAGCCATTGGCAAGACCAAGGAGGAATTTGCGCGCGAGCTCCGCGAGAGGAAC
GCTACCGCCGTCGCCGAGCTCTGCGACGACTCCTTCGAAGAGCACATTCTCGCGTATGAACCAGAGAAAGCCGGC
CTATACCTTCACGGCATTAACCACAACTTGCCCATCTTTTCCACCTATGCCAGCTCTGACGTCCAAGATTTTGCC
GACCAGTGGGGTTTTCGCAAAATTGGATTCATCACCATGAACGACGTGAAGTCCGTCAAGGCATTCCTCGAAGAG
ACGGCCCGAACGGGAGCTTACGAAGGCCGGGACATTGAGGGCTTCGTTATTCGCTGCAAGATGAGTACCGAACCG
GAAGTCAAGCCCTATCAAGACTGGTTCTTCAAGTTCAAGTTCGATGAGCCATATCTCATGTATCGGCAATGGCGC
GAGGTGACGAAAATGATGATCAGCGGGAAAGAGCCTACCTACAAGAGGCACAAGTTAATCACGGGGAAATACCTT
GAGTTCGCTCGCAAACGGCTGGCTGCCGATCCAGAGCTAGGCCGGCGGTATCTGGAGAATCATGGCATTATTGCC
CTGCGCAATGACTTTCTTCGAGCCGAAAATCTGAAAGGCTCCGAGGCGGCTGACATGGACGAACCGGCAGGAGTC
AAGGACAAACCGAAAGTAGAGATCATGTCCGACGTTACTGGAAACGTGATTTTGTGCCCGGTGGCAACGATAGGC
TGCGGCAAGACAACCTGCGCCATGGCGCTGTCTCAACTCTTCGGATGGGGCCATGTACAGAACGACAACATAGCC
GGCAGAAATCGTCCGCCCAGGTTTACCCGTGCTGTTCTCGAAGGGCTGAAGGGGCGCCCGGCCGTCTTCGCAGAC
CGGAATAACACGGAAAAGAGAGAAAGATTACAGCTTCTAAGGGACTTGAAGGAAAAGAACGGCCAGGTCAAGGTG
GTTTGTCTCCACTATGTCCATGACGAGGCAAACATGGACAATATTCGACAGTTGACCACACAGAGGGTGAAGCTT
CGCGGCGATAACCACCAGACAATCAAGGCCGCCAGGGATCCGGAGAAGCAGGAGACCATCATGGGTGGCTTTTTG
GGACGATACGAGCCCTGTGAACCGTGGAGTCATCCCGACTCGGGGTTCGACTTGGTCATCGACCTGGATCCTCTG
GCTGACAGCCGCGTAAATCTCGAGACGATCGTGACGCAGCTACACAAGTATTTCCCGCACTTGATGAATTTACCG
TCATCGGAGCAGCTGGACAGTGCCATCAAACATGCACTCGAACACAAGATTCCGCAATCCGAACCAATGCGCCAG
AAAAAGGGACGGGATTATTGGGTTCACAACTTGCACTACATGTCGGTGAATGTCGAGAGCAAGGCCGTCAATGAA
GCCCTCCAACAGGCTTTTGAAGCCGCCGACGAACAGACTAGCGGCTTCTTCAAGAAGCTGAAGTTGACTGGAAGG
GTTCAGAAAGACTTTCACGTCACGCTCATACATCGTTCATCCTCGAAGGACTATCCGGAGCTGTGGCAGCGATAT
ATGAATGCGTTGGAACCCGTTGAAGGGGACGATGGGAAGATTGGCGAATGCAGTGTAGTACTCGAACGGATTGTG
TTTGATGATCGCATCATGGCCATTGTGGTCCGTTTGGTGGACGAGGAAGGGAAGTGGGAGTGCGTGAACCGGGTT
GCTCACATCACAGTCGGCACTCGGGATGCGTCGATCAAGGCCAAGGAAAGCAACGACTTGCTGGCCAAGTGGCTA
GACGGGGGAGTCAAGAAGGGCCTGATGCAAGAGCTTGTCTTTGAGCAGAAGCCGACGATCGCAGGCAATGTCGGG
GCTGTGCGTCTTAGA
Transcript >Ophio5|4543
ATGAACGTCGTATCAAGGTCTGCGCAAAGACTGCTTTCACTGCGTCACTGTCGCGTCGTTCCAAGCATGGCGGCG
CCGCCGCCCACAACTCACCTTGCCACTCAACACATTCCCGGGCAAGTCCAGTCTCTGGCCACTGTCGCTCCACAA
GCCAATGAAGAAAGCTTGGCCCCTGTTATGGAGTTCCTTGAAAACGGTCTCAAGAAGAAGAATAAGTTCGCTATT
TTATCACGTAAGACAACTTTCGACGTCAAATCATCTCGTGACGGCATCAAGCTCGACTCATGGAGGCTTCGCGAG
CACGATTACAAGAGGCAGTGGTTACCCACTTACGCCCGAGGACTCTTTACAACCAAGAGGAAAGACGGCACCCCT
GAGATCGCTGTTAGGGGTTACGATAAGTTCTTCAACATTGGTGAGGTCAGACATACCAAGTGGGAAAATATCATT
ACCCAGACGAAGCCGCCGTACGACCTGACTCTCAAGGAAAACGGCTGCATCATCTTCTTTGCTGGCCTCGAGGAC
GGAACACTTGTCGTTTGCAGCAAGCACTCGACCGGCGACCGACCCAACTGCGTGAGCCATGCTAATGCTGGCGAG
GCTCTCTTGGAGAAACAACTGGCAGCCATTGGCAAGACCAAGGAGGAATTTGCGCGCGAGCTCCGCGAGAGGAAC
GCTACCGCCGTCGCCGAGCTCTGCGACGACTCCTTCGAAGAGCACATTCTCGCGTATGAACCAGAGAAAGCCGGC
CTATACCTTCACGGCATTAACCACAACTTGCCCATCTTTTCCACCTATGCCAGCTCTGACGTCCAAGATTTTGCC
GACCAGTGGGGTTTTCGCAAAATTGGATTCATCACCATGAACGACGTGAAGTCCGTCAAGGCATTCCTCGAAGAG
ACGGCCCGAACGGGAGCTTACGAAGGCCGGGACATTGAGGGCTTCGTTATTCGCTGCAAGATGAGTACCGAACCG
GAAGTCAAGCCCTATCAAGACTGGTTCTTCAAGTTCAAGTTCGATGAGCCATATCTCATGTATCGGCAATGGCGC
GAGGTGACGAAAATGATGATCAGCGGGAAAGAGCCTACCTACAAGAGGCACAAGTTAATCACGGGGAAATACCTT
GAGTTCGCTCGCAAACGGCTGGCTGCCGATCCAGAGCTAGGCCGGCGGTATCTGGAGAATCATGGCATTATTGCC
CTGCGCAATGACTTTCTTCGAGCCGAAAATCTGAAAGGCTCCGAGGCGGCTGACATGGACGAACCGGCAGGAGTC
AAGGACAAACCGAAAGTAGAGATCATGTCCGACGTTACTGGAAACGTGATTTTGTGCCCGGTGGCAACGATAGGC
TGCGGCAAGACAACCTGCGCCATGGCGCTGTCTCAACTCTTCGGATGGGGCCATGTACAGAACGACAACATAGCC
GGCAGAAATCGTCCGCCCAGGTTTACCCGTGCTGTTCTCGAAGGGCTGAAGGGGCGCCCGGCCGTCTTCGCAGAC
CGGAATAACACGGAAAAGAGAGAAAGATTACAGCTTCTAAGGGACTTGAAGGAAAAGAACGGCCAGGTCAAGGTG
GTTTGTCTCCACTATGTCCATGACGAGGCAAACATGGACAATATTCGACAGTTGACCACACAGAGGGTGAAGCTT
CGCGGCGATAACCACCAGACAATCAAGGCCGCCAGGGATCCGGAGAAGCAGGAGACCATCATGGGTGGCTTTTTG
GGACGATACGAGCCCTGTGAACCGTGGAGTCATCCCGACTCGGGGTTCGACTTGGTCATCGACCTGGATCCTCTG
GCTGACAGCCGCGTAAATCTCGAGACGATCGTGACGCAGCTACACAAGTATTTCCCGCACTTGATGAATTTACCG
TCATCGGAGCAGCTGGACAGTGCCATCAAACATGCACTCGAACACAAGATTCCGCAATCCGAACCAATGCGCCAG
AAAAAGGGACGGGATTATTGGGTTCACAACTTGCACTACATGTCGGTGAATGTCGAGAGCAAGGCCGTCAATGAA
GCCCTCCAACAGGCTTTTGAAGCCGCCGACGAACAGACTAGCGGCTTCTTCAAGAAGCTGAAGTTGACTGGAAGG
GTTCAGAAAGACTTTCACGTCACGCTCATACATCGTTCATCCTCGAAGGACTATCCGGAGCTGTGGCAGCGATAT
ATGAATGCGTTGGAACCCGTTGAAGGGGACGATGGGAAGATTGGCGAATGCAGTGTAGTACTCGAACGGATTGTG
TTTGATGATCGCATCATGGCCATTGTGGTCCGTTTGGTGGACGAGGAAGGGAAGTGGGAGTGCGTGAACCGGGTT
GCTCACATCACAGTCGGCACTCGGGATGCGTCGATCAAGGCCAAGGAAAGCAACGACTTGCTGGCCAAGTGGCTA
GACGGGGGAGTCAAGAAGGGCCTGATGCAAGAGCTTGTCTTTGAGCAGAAGCCGACGATCGCAGGCAATGTCGGG
GCTGTGCGTCTTAGATGA
Gene >Ophio5|4543
ATGAACGTCGTATCAAGGTCTGCGCAAAGACTGTAAGCTCTCCTTGCCAATGCCTCGCCGCACTCGCGCCAGAAA
AGGTCATACCTCTAAACCCTCGTCCAGGCTTTCACTGCGTCACTGTCGCGTCGTTCCAAGCATGGCGGCGCCGCC
GCCCACAACTCACCTTGCCACTCAACACATTCCCGGGCAAGTCCAGTCTCTGGCCACTGTCGCTCCACAAGCCAA
TGAAGAAAGCTTGGCCCCTGTTATGGAGTTCCTTGAAAACGGTCTCAAGAAGAAGAATAAGTTCGCTATTTTATC
ACGTAAGACAACTTTCGACGTCAAATCATCTCGTGACGGCATCAAGCTCGACTCATGGAGGCTTCGCGAGCACGA
TTACAAGAGGCAGTGGTTACCCACTTACGCCCGAGGACTCTTTACAACCAAGAGGAAAGACGGCACCCCTGAGAT
CGCTGTTAGGGGTTACGATAAGTTCTTCAACATTGGTGAGGTCAGACATACCAAGTGGGAAAATATCATTACCCA
GACGAAGCCGCCGTACGACCTGACTCTCAAGGAAAACGGCTGCATCATCTTCTTTGCTGGCCTCGAGGACGGAAC
ACTTGTCGTTTGCAGCAAGCACTCGACCGGCGACCGACCCAACTGCGTGAGCCATGCTAATGCTGGCGAGGCTCT
CTTGGAGAAACAACTGGCAGCCATTGGCAAGACCAAGGAGGAATTTGCGCGCGAGCTCCGCGAGAGGAACGCTAC
CGCCGTCGCCGAGCTCTGCGACGACTCCTTCGAAGAGCACATTCTCGCGTATGAACCAGAGAAAGCCGGCCTATA
CCTTCACGGCATTAACCACAACTTGCCCATCTTTTCCACCTATGCCAGCTCTGACGTCCAAGATTTTGCCGACCA
GTGGGGTTTTCGCAAAATTGGATTCATCACCATGAACGACGTGAAGTCCGTCAAGGCATTCCTCGAAGAGACGGC
CCGAACGGGAGCTTACGAAGGCCGGGACATTGAGGGCTTCGTTATTCGCTGCAAGATGAGTACCGAACCGGAAGT
CAAGCCCTATCAAGACTGGTTCTTCAAGTTCAAGTTCGATGAGCCATATCTCATGTATCGGCAATGGCGCGAGGT
GACGAAAATGATGATCAGCGGGAAAGAGCCTACCTACAAGAGGCACAAGTTAATCACGGGGAAATACCTTGAGTT
CGCTCGCAAACGGCTGGCTGCCGATCCAGAGCTAGGCCGGCGGTATCTGGAGAATCATGGCATTATTGCCCTGCG
CAATGACTTTCTTCGAGCCGAAAATCTGAAAGGCTCCGAGGCGGCTGACATGGACGAACCGGCAGGAGTCAAGGA
CAAACCGAAAGTAGAGATCATGTCCGACGTTACTGGAAACGTGATTTTGTGCCCGGTGGCAACGATAGGCTGCGG
CAAGACAACCTGCGCCATGGCGCTGTCTCAACTCTTCGGATGGGGCCATGTACAGAACGACAACATAGCCGGCAG
AAATCGTCCGCCCAGGTTTACCCGTGCTGTTCTCGAAGGGCTGAAGGGGCGCCCGGCCGTCTTCGCAGACCGGAA
TAACACGGAAAAGAGAGAAAGATTACAGCTTCTAAGGGACTTGAAGGAAAAGAACGGCCAGGTCAAGGTGGTTTG
TCTCCACTATGTCCATGACGAGGCAAACATGGACAATATTCGACAGTTGACCACACAGAGGGTGAAGCTTCGCGG
CGATAACCACCAGACAATCAAGGCCGCCAGGGATCCGGAGAAGCAGGAGACCATCATGGGTGGCTTTTTGGGACG
ATACGAGCCCTGTGAACCGTGGAGTCATCCCGACTCGGGGTTCGACTTGGTCATCGACCTGGATCCTCTGGCTGA
CAGCCGCGTAAATCTCGAGACGATCGTGACGCAGCTACACAAGTATTTCCCGCACTTGATGAATTTACCGTCATC
GGAGCAGCTGGACAGTGCCATCAAACATGCACTCGAACACAAGATTCCGCAATCCGAACCAATGCGCCAGAAAAA
GGGACGGGATTATTGGGTTCACAACTTGCACTACATGTCGGTGAATGTCGAGAGCAAGGCCGTCAATGAAGCCCT
CCAACAGGCTTTTGAAGCCGCCGACGAACAGACTAGCGGCTTCTTCAAGAAGCTGAAGTTGACTGGAAGGGTTCA
GAAAGACTTTCACGTCACGCTCATACATCGTTCATCCTCGAAGGACTATCCGGAGCTGTGGCAGCGATATATGAA
TGCGTTGGAACCCGTTGAAGGGGACGATGGGAAGATTGGCGAATGCAGTGTAGTACTCGAACGGGTACGCAGAAT
TCCAGTCCACTCTTTTACATTGTTCGTGTCCGAGCTACTGACCGTCACGAATCCAGATTGTGTTTGATGATCGCA
TCATGGCCATTGTGGTCCGTTTGGTGGACGAGGAAGGGAAGTGGGAGTGCGTGAACCGGGTTGCTCACATCACAG
TCGGCACTCGGGATGCGTCGATCAAGGCCAAGGAAAGCAACGACTTGCTGGCCAAGTGGCTAGACGGGGGAGTCA
AGAAGGGCCTGATGCAAGAGCTTGTCTTTGAGCAGAAGCCGACGATCGCAGGCAATGTCGGGGCTGTGCGTCTTA
GATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail