Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|454
Gene name
Locationscaffold_110:24163..26300
Strand-
Gene length (bp)2137
Transcript length (bp)1938
Coding sequence length (bp)1935
Protein length (aa) 645

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08418 Pol_alpha_B_N DNA polymerase alpha subunit B N-terminal 1.8E-58 21 230
PF04042 DNA_pol_E_B DNA polymerase alpha/epsilon subunit B 5.3E-42 352 587

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74946|DPOA2_SCHPO DNA polymerase alpha subunit B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pol12 PE=1 SV=1 25 645 2.0E-93
sp|P38121|DPOA2_YEAST DNA polymerase alpha subunit B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POL12 PE=1 SV=1 174 643 6.0E-79
sp|Q14181|DPOA2_HUMAN DNA polymerase alpha subunit B OS=Homo sapiens GN=POLA2 PE=1 SV=2 143 617 2.0E-47
sp|P33611|DPOA2_MOUSE DNA polymerase alpha subunit B OS=Mus musculus GN=Pola2 PE=1 SV=2 112 614 3.0E-46
sp|O89043|DPOA2_RAT DNA polymerase alpha subunit B OS=Rattus norvegicus GN=Pola2 PE=1 SV=2 143 614 9.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74946|DPOA2_SCHPO DNA polymerase alpha subunit B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pol12 PE=1 SV=1 25 645 2.0E-93
sp|P38121|DPOA2_YEAST DNA polymerase alpha subunit B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POL12 PE=1 SV=1 174 643 6.0E-79
sp|Q14181|DPOA2_HUMAN DNA polymerase alpha subunit B OS=Homo sapiens GN=POLA2 PE=1 SV=2 143 617 2.0E-47
sp|P33611|DPOA2_MOUSE DNA polymerase alpha subunit B OS=Mus musculus GN=Pola2 PE=1 SV=2 112 614 3.0E-46
sp|O89043|DPOA2_RAT DNA polymerase alpha subunit B OS=Rattus norvegicus GN=Pola2 PE=1 SV=2 143 614 9.0E-46
sp|Q58D13|DPOA2_BOVIN DNA polymerase alpha subunit B OS=Bos taurus GN=POLA2 PE=2 SV=1 112 588 3.0E-42
sp|Q9VB62|DPOA2_DROME DNA polymerase alpha subunit B OS=Drosophila melanogaster GN=DNApol-alpha73 PE=1 SV=2 119 629 2.0E-30
sp|Q21625|DPOA2_CAEEL DNA polymerase alpha subunit B OS=Caenorhabditis elegans GN=div-1 PE=3 SV=3 224 645 1.0E-18
[Show less]

GO

GO Term Description Terminal node
GO:0006260 DNA replication Yes
GO:0003677 DNA binding Yes
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006259 DNA metabolic process No
GO:0044238 primary metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0003676 nucleic acid binding No
GO:0046483 heterocycle metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0008152 metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0044260 cellular macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0006807 nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|454
MADDEAELSARFAGGKTLEADVTAELQSVMRLYELSAEDVLFKWETYCLRRGHDAGEVSLPAVRGLKYSIHEELE
RERREALVKKKEKKRAVAPTAKAGAVDVMGMLDSLMPTTPRAGPARAKRKLDSGIASSPVTGENASSFSDRAKPG
EVIEVLNDHLAAATAPKRAFTEARVKLTAASDQKKMGYKPLAMKLSEASEILDDRIDDWAALVQEHHGLDDSAFG
NAAAQGTSEIVAVGRIASDTTSDEGGRLNAASLVLETSRRTGMGFRVPLKMDAIERWSFFPGQIVALKGSNASGH
EFVVKELVDAPLLPGAASTLSALESGRERLRGGHDDDGGGGDGTEEPAPLSVVFASGPYTADDNLDYEPLHALCG
RAADGGVDALVLTGPFLDIDHPLIASGDFDLPEDAGIDPDTANMTTVFKYLFAPALNRLASSRPHLAVILVPSVR
DVIAKHVSWPQDAFPRKDLGLPRTVRIVSNPMTLSLNEMLLAVSSQDVLYQLRGQEVVAKGPSPGDLMRRLCRYL
VEQRHYFPLFPPTAREKLPRTGTEEGIATGAVLDLSYLKLGEMINVRPDVMLVPSALPPFVKVVESVLAINPGHL
SKRKGAGTYAHMTLHAPEVGDAVSSVDAVVGHKIFDRARVEIVRI
Coding >Ophio5|454
ATGGCAGACGACGAGGCGGAGCTCTCTGCGCGGTTCGCGGGGGGCAAGACGCTGGAGGCAGACGTGACGGCGGAG
CTGCAATCCGTGATGCGGCTGTACGAGCTCTCAGCCGAAGATGTCCTCTTCAAATGGGAGACTTACTGCCTACGG
AGAGGGCACGACGCGGGCGAAGTGTCGCTACCTGCGGTGCGCGGCCTCAAGTATAGCATCCACGAGGAGCTCGAG
AGGGAACGGCGAGAGGCGCTCGTCAAGAAGAAGGAGAAGAAGAGGGCGGTTGCGCCGACGGCTAAGGCCGGCGCT
GTCGATGTCATGGGTATGCTCGACTCTTTGATGCCCACTACGCCTAGGGCTGGGCCTGCGAGGGCAAAGCGGAAG
TTGGATTCGGGGATTGCCTCGTCGCCGGTGACGGGGGAGAATGCCTCGTCGTTTAGCGATAGGGCCAAGCCGGGT
GAGGTGATTGAGGTGCTCAACGACCATCTCGCCGCTGCGACGGCGCCAAAGAGGGCCTTTACCGAGGCCCGTGTC
AAGCTCACGGCGGCATCGGATCAGAAGAAGATGGGGTACAAGCCGCTGGCGATGAAGCTTTCCGAAGCGAGTGAG
ATACTCGACGACCGCATCGACGACTGGGCCGCGCTGGTACAGGAGCATCACGGGCTAGACGACTCGGCGTTTGGC
AACGCCGCGGCACAGGGCACATCGGAAATCGTCGCCGTCGGACGCATCGCCTCGGATACGACATCGGACGAGGGC
GGCAGGCTCAACGCCGCCTCGCTCGTGCTCGAGACGTCGCGCCGTACGGGCATGGGCTTTAGGGTACCGCTCAAA
ATGGATGCCATCGAACGCTGGAGCTTCTTCCCAGGACAGATTGTAGCCCTCAAGGGGAGCAACGCGAGCGGACAC
GAGTTTGTCGTCAAGGAACTTGTCGATGCGCCGCTGTTGCCGGGCGCTGCCTCGACGCTTTCCGCGCTCGAGTCT
GGTAGGGAGAGGCTGCGAGGTGGACATGATGATGATGGTGGTGGTGGTGATGGTACAGAGGAGCCGGCGCCGTTG
AGCGTCGTCTTTGCGTCTGGACCTTACACGGCTGACGATAATCTCGACTATGAGCCTCTTCATGCGCTGTGCGGT
CGCGCGGCGGATGGTGGCGTCGACGCGCTCGTGCTGACTGGACCCTTTCTTGATATTGACCATCCGCTCATCGCA
AGCGGTGACTTTGACCTCCCCGAAGACGCGGGCATCGATCCGGACACAGCCAACATGACGACCGTCTTCAAATAC
CTATTCGCGCCGGCCCTGAACCGACTGGCATCATCACGACCACACCTCGCCGTCATCCTAGTCCCCTCTGTGCGA
GACGTAATCGCCAAGCACGTCTCCTGGCCACAAGACGCCTTCCCACGCAAGGACCTAGGCCTTCCACGAACGGTA
CGCATCGTATCGAACCCCATGACCCTCTCGCTCAACGAGATGCTCCTGGCCGTCTCTTCGCAAGACGTGCTGTAC
CAACTGCGCGGACAAGAGGTTGTTGCCAAGGGCCCTTCGCCGGGCGATTTGATGAGGAGGCTGTGTCGATACCTG
GTGGAGCAGAGACATTACTTTCCGCTTTTCCCGCCTACCGCCCGCGAGAAACTTCCTAGGACGGGCACGGAGGAG
GGCATCGCTACCGGTGCCGTCCTTGACCTGAGCTACTTGAAGCTCGGCGAGATGATTAATGTTCGACCCGATGTG
ATGCTCGTGCCCAGCGCGCTACCGCCATTTGTCAAGGTTGTCGAGAGCGTCCTCGCCATCAACCCGGGCCACCTC
TCGAAGCGCAAAGGCGCCGGCACCTACGCCCACATGACGCTACACGCCCCCGAAGTCGGCGACGCGGTATCATCA
GTCGATGCCGTGGTGGGCCACAAGATATTCGACAGGGCCCGCGTCGAGATTGTGAGGATT
Transcript >Ophio5|454
ATGGCAGACGACGAGGCGGAGCTCTCTGCGCGGTTCGCGGGGGGCAAGACGCTGGAGGCAGACGTGACGGCGGAG
CTGCAATCCGTGATGCGGCTGTACGAGCTCTCAGCCGAAGATGTCCTCTTCAAATGGGAGACTTACTGCCTACGG
AGAGGGCACGACGCGGGCGAAGTGTCGCTACCTGCGGTGCGCGGCCTCAAGTATAGCATCCACGAGGAGCTCGAG
AGGGAACGGCGAGAGGCGCTCGTCAAGAAGAAGGAGAAGAAGAGGGCGGTTGCGCCGACGGCTAAGGCCGGCGCT
GTCGATGTCATGGGTATGCTCGACTCTTTGATGCCCACTACGCCTAGGGCTGGGCCTGCGAGGGCAAAGCGGAAG
TTGGATTCGGGGATTGCCTCGTCGCCGGTGACGGGGGAGAATGCCTCGTCGTTTAGCGATAGGGCCAAGCCGGGT
GAGGTGATTGAGGTGCTCAACGACCATCTCGCCGCTGCGACGGCGCCAAAGAGGGCCTTTACCGAGGCCCGTGTC
AAGCTCACGGCGGCATCGGATCAGAAGAAGATGGGGTACAAGCCGCTGGCGATGAAGCTTTCCGAAGCGAGTGAG
ATACTCGACGACCGCATCGACGACTGGGCCGCGCTGGTACAGGAGCATCACGGGCTAGACGACTCGGCGTTTGGC
AACGCCGCGGCACAGGGCACATCGGAAATCGTCGCCGTCGGACGCATCGCCTCGGATACGACATCGGACGAGGGC
GGCAGGCTCAACGCCGCCTCGCTCGTGCTCGAGACGTCGCGCCGTACGGGCATGGGCTTTAGGGTACCGCTCAAA
ATGGATGCCATCGAACGCTGGAGCTTCTTCCCAGGACAGATTGTAGCCCTCAAGGGGAGCAACGCGAGCGGACAC
GAGTTTGTCGTCAAGGAACTTGTCGATGCGCCGCTGTTGCCGGGCGCTGCCTCGACGCTTTCCGCGCTCGAGTCT
GGTAGGGAGAGGCTGCGAGGTGGACATGATGATGATGGTGGTGGTGGTGATGGTACAGAGGAGCCGGCGCCGTTG
AGCGTCGTCTTTGCGTCTGGACCTTACACGGCTGACGATAATCTCGACTATGAGCCTCTTCATGCGCTGTGCGGT
CGCGCGGCGGATGGTGGCGTCGACGCGCTCGTGCTGACTGGACCCTTTCTTGATATTGACCATCCGCTCATCGCA
AGCGGTGACTTTGACCTCCCCGAAGACGCGGGCATCGATCCGGACACAGCCAACATGACGACCGTCTTCAAATAC
CTATTCGCGCCGGCCCTGAACCGACTGGCATCATCACGACCACACCTCGCCGTCATCCTAGTCCCCTCTGTGCGA
GACGTAATCGCCAAGCACGTCTCCTGGCCACAAGACGCCTTCCCACGCAAGGACCTAGGCCTTCCACGAACGGTA
CGCATCGTATCGAACCCCATGACCCTCTCGCTCAACGAGATGCTCCTGGCCGTCTCTTCGCAAGACGTGCTGTAC
CAACTGCGCGGACAAGAGGTTGTTGCCAAGGGCCCTTCGCCGGGCGATTTGATGAGGAGGCTGTGTCGATACCTG
GTGGAGCAGAGACATTACTTTCCGCTTTTCCCGCCTACCGCCCGCGAGAAACTTCCTAGGACGGGCACGGAGGAG
GGCATCGCTACCGGTGCCGTCCTTGACCTGAGCTACTTGAAGCTCGGCGAGATGATTAATGTTCGACCCGATGTG
ATGCTCGTGCCCAGCGCGCTACCGCCATTTGTCAAGGTTGTCGAGAGCGTCCTCGCCATCAACCCGGGCCACCTC
TCGAAGCGCAAAGGCGCCGGCACCTACGCCCACATGACGCTACACGCCCCCGAAGTCGGCGACGCGGTATCATCA
GTCGATGCCGTGGTGGGCCACAAGATATTCGACAGGGCCCGCGTCGAGATTGTGAGGATTTGA
Gene >Ophio5|454
ATGGCAGACGACGAGGCGGAGCTCTCTGCGCGGTTCGCGGGGGGCAAGACGCTGGAGGCAGACGTGACGGCGGAG
CTGCAATCCGTGATGCGGCTGTACGAGCTCTCAGCCGAAGATGTCCTCTTCAAATGGGAGACTTACTGCCTACGG
AGAGGGCACGACGCGGGCGAAGTGTCGCTACCTGCGGTGCGCGGCCTCAAGTATAGCATCCACGAGGAGCTCGAG
AGGGAACGGCGAGAGGCGCTCGTCAAGAAGAAGGAGAAGAAGAGGGCGGTTGCGCCGACGGCTAAGGCCGGCGCT
GTCGATGTCATGGGTATGCTCGACTCTTTGATGCCCACTACGCCTAGGGCTGGGCCTGCGAGGGCAAAGCGGAAG
TTGGATTCGGGGATTGCCTCGTCGCCGGTGACGGGGGAGAATGCGTACGTCGTTCTTCACTCGACAAGTCTCGGT
GTTTCCGGCTTGCTAACGTTTTTTTTTTTCTTTTTTTTTTTTACCAGGACCAGCTCGTCGTTTAGCGATAGGGCC
AAGCCGGGTGAGGTGATTGAGGTGCTCAACGACCATCTCGCCGCTGCGACGGCGCCAAAGAGGGCCTTTACCGAG
GCCCGTGTCAAGCTCACGGCGGCATCGGATCAGAAGAAGATGGGGTACAAGCCGCTGGCGATGAAGCTTTCCGAA
GCGAGTGAGATACTCGACGACCGCATCGACGACTGGGCCGCGCTGGTACAGGAGCATCACGGGCTAGACGACTCG
GCGTTTGGCAACGCCGCGGCACAGGGCACATCGGAAATCGTCGCCGTCGGACGCATCGCCTCGGATACGACATCG
GACGAGGGCGGCAGGCTCAACGCCGCCTCGCTCGTGCTCGAGACGTCGCGCCGTACGGGCATGGGCTTTAGGGTA
CCGCTCAAAATGGATGCCATCGAACGCTGGAGCTTCTTCCCAGGACAGATTGTAGCCCTCAAGGGGAGCAACGCG
AGCGGACACGAGTTTGTCGTCAAGGAACTTGTCGATGCGCCGCTGTTGCCGGGCGCTGCCTCGACGCTTTCCGCG
CTCGAGTCTGGTAGGGAGAGGCTGCGAGGTGGACATGATGATGATGGTGGTGGTGGTGATGGTACAGAGGAGCCG
GCGCCGTTGAGCGTCGTCTTTGCGTCTGGACCTTACACGGCTGACGATAATCTCGACTATGAGCCTCTTCATGCG
CTGTGCGGTCGCGCGGCGGATGGTGGCGTCGACGCGCTCGTGCTGACTGGACCCTTTCTTGATATTGACCATCCG
CTCATCGCAAGCGGTGACTTTGACCTCCCCGAAGACGCGGGCATCGATCCGGACACAGCCAACATGACGACCGTC
TTCAAATACCTATTCGCGCCGGCCCTGAACCGACTGGCATCATCACGACCACACCTCGCCGTCATCCTAGTCCCC
TCTGTGCGAGACGTAATCGCCAAGCACGTCTCCTGGCCACAAGACGCCTTCCCACGCAAGGACCTAGGCCTTCCA
CGAACGGTACGCATCGTATCGAACCCCATGACCCTCTCGCTCAACGAGATGCTCCTGGCCGTCTCTTCGCAAGAC
GTGCTGTACCAACTGCGCGGACAAGAGGTTGTTGCCAAGGGCCCTTCGCCGGGCGATTTGATGAGGAGGCTGTGT
CGATACCTGGTGGAGCAGAGACATTACTTTCCGCTTTTCCCGCCTACCGCCCGCGAGAAACTTCCTAGGACGGGC
ACGGAGGAGGGCATCGCTACCGGTGCCGTCCTTGACCTGAGCTACTTGAAGCTCGGCGAGATGATTAATGTTCGA
CCCGATGTGATGCTCGTGCCCAGCGCGCTACCGCCATTTGTCAAGGTGAGCAACGACGAAATCATTCTCTTTTCT
TTTCTTTTCTTTTCTTCTCTTCTCTTTTTTCCATACCAATCATGGCTGACGCGCCAATAATGAAAAAAAAAAAAA
AAAAAAAAAGGTTGTCGAGAGCGTCCTCGCCATCAACCCGGGCCACCTCTCGAAGCGCAAAGGCGCCGGCACCTA
CGCCCACATGACGCTACACGCCCCCGAAGTCGGCGACGCGGTATCATCAGTCGATGCCGTGGTGGGCCACAAGAT
ATTCGACAGGGCCCGCGTCGAGATTGTGAGGATTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail