Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4534
Gene name
Locationscaffold_36:43700..44904
Strand-
Gene length (bp)1204
Transcript length (bp)876
Coding sequence length (bp)873
Protein length (aa) 291

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04148 Erv26 Transmembrane adaptor Erv26 3.5E-88 1 192

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38869|SVP26_YEAST Protein SVP26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SVP26 PE=1 SV=1 3 193 7.0E-50
sp|Q1MTR8|SVP26_SCHPO Protein svp26 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=svp26 PE=3 SV=1 1 171 1.0E-38
sp|Q6UWH6|TX261_HUMAN Protein TEX261 OS=Homo sapiens GN=TEX261 PE=2 SV=1 1 197 3.0E-33
sp|Q5BJW3|TX261_RAT Protein TEX261 OS=Rattus norvegicus GN=Tex261 PE=2 SV=1 1 197 9.0E-33
sp|Q62302|TX261_MOUSE Protein TEX261 OS=Mus musculus GN=Tex261 PE=2 SV=1 1 197 9.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38869|SVP26_YEAST Protein SVP26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SVP26 PE=1 SV=1 3 193 7.0E-50
sp|Q1MTR8|SVP26_SCHPO Protein svp26 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=svp26 PE=3 SV=1 1 171 1.0E-38
sp|Q6UWH6|TX261_HUMAN Protein TEX261 OS=Homo sapiens GN=TEX261 PE=2 SV=1 1 197 3.0E-33
sp|Q5BJW3|TX261_RAT Protein TEX261 OS=Rattus norvegicus GN=Tex261 PE=2 SV=1 1 197 9.0E-33
sp|Q62302|TX261_MOUSE Protein TEX261 OS=Mus musculus GN=Tex261 PE=2 SV=1 1 197 9.0E-33
sp|Q5RFE0|TX261_PONAB Protein TEX261 OS=Pongo abelii GN=TEX261 PE=2 SV=1 1 197 7.0E-32
sp|Q58DA4|TX261_BOVIN Protein TEX261 OS=Bos taurus GN=TEX261 PE=2 SV=1 24 197 8.0E-29
sp|Q54ER8|TX261_DICDI Protein TEX261 homolog OS=Dictyostelium discoideum GN=DDB_G0291374 PE=3 SV=1 3 167 2.0E-22
[Show less]

GO

GO Term Description Terminal node
GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Yes
GO:0097020 COPII receptor activity Yes
GO:0016021 integral component of membrane Yes
GO:0008150 biological_process No
GO:0016192 vesicle-mediated transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0038024 cargo receptor activity No
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No
GO:0006810 transport No
GO:0048193 Golgi vesicle transport No
GO:0046907 intracellular transport No
GO:0051234 establishment of localization No
GO:0009987 cellular process No
GO:0051641 cellular localization No
GO:0051649 establishment of localization in cell No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 60 82 22
3 95 112 17
4 137 159 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 190.73 103.72 277.74
CcL In ants, during behavior modification 146.28 77.56 214.99
CcD In ants, recently dead 123.20 67.26 179.14

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.268332 no
SC16a CcD 0.045635 yes
CcL CcD 0.489195 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4534
MWILPLVGYAGALVGFCFLTLAIASGLYYLSELVEEHTVIAKRLLTRLIYTVVGLQISLWLLDGFPFWSTLLGIA
AHGVYLGNLRRFPFVKLSDPLFLLACVLVLVDHYVWFRHFSHGQTRAYQRSSYYDDVDVPSFTMIASYFGLCVWL
VPFALFVSLSASDNVLPTMGSEPVRGVDGKNRHQGMVKAVVDSSPLPLPLTRLASKIEAFAQAGAVFRELSQPLS
LTIASQLSQTDDEKAPGYVFFFWKKPGSGLSSGRDEAAPSCVCGLGPKIYECRPWGTEALPGIQTW
Coding >Ophio5|4534
ATGTGGATTCTGCCGCTCGTCGGCTACGCTGGCGCTCTCGTCGGCTTCTGCTTCCTGACGCTGGCCATCGCCTCC
GGGCTCTACTACCTGTCGGAGCTCGTCGAGGAACACACCGTCATAGCGAAGCGTCTCCTGACGCGCCTCATCTAC
ACCGTCGTCGGCCTGCAGATTTCTCTGTGGCTTCTGGACGGCTTCCCCTTCTGGTCGACCTTGCTGGGCATCGCT
GCTCACGGCGTCTACCTCGGCAACCTGAGGCGCTTCCCGTTTGTGAAGCTGTCAGATCCGCTCTTCCTGCTCGCA
TGTGTCCTCGTTCTTGTCGATCACTATGTCTGGTTCAGACACTTTTCACACGGCCAGACGCGTGCCTACCAACGC
TCGTCTTACTATGACGACGTCGACGTCCCAAGTTTTACCATGATTGCCTCTTACTTCGGCCTGTGTGTCTGGCTC
GTCCCCTTTGCGCTCTTTGTTAGCTTGTCTGCCAGCGATAACGTCTTGCCCACCATGGGCAGCGAGCCAGTGCGT
GGCGTCGACGGCAAGAACAGGCATCAGGGCATGGTCAAGGCCGTCGTTGACAGTTCGCCGCTTCCCCTACCCCTT
ACTCGCCTTGCTTCGAAGATCGAGGCATTCGCACAAGCAGGAGCAGTGTTCCGCGAACTCTCACAGCCGCTTTCG
CTTACCATCGCCAGCCAGCTTTCCCAGACTGACGATGAGAAGGCGCCGGGATATGTGTTTTTCTTTTGGAAGAAG
CCAGGCAGCGGTTTATCCTCCGGCCGAGATGAAGCAGCCCCGTCCTGTGTGTGCGGCCTTGGACCTAAGATCTAT
GAATGCCGGCCATGGGGGACGGAAGCGTTGCCTGGTATTCAGACTTGG
Transcript >Ophio5|4534
ATGTGGATTCTGCCGCTCGTCGGCTACGCTGGCGCTCTCGTCGGCTTCTGCTTCCTGACGCTGGCCATCGCCTCC
GGGCTCTACTACCTGTCGGAGCTCGTCGAGGAACACACCGTCATAGCGAAGCGTCTCCTGACGCGCCTCATCTAC
ACCGTCGTCGGCCTGCAGATTTCTCTGTGGCTTCTGGACGGCTTCCCCTTCTGGTCGACCTTGCTGGGCATCGCT
GCTCACGGCGTCTACCTCGGCAACCTGAGGCGCTTCCCGTTTGTGAAGCTGTCAGATCCGCTCTTCCTGCTCGCA
TGTGTCCTCGTTCTTGTCGATCACTATGTCTGGTTCAGACACTTTTCACACGGCCAGACGCGTGCCTACCAACGC
TCGTCTTACTATGACGACGTCGACGTCCCAAGTTTTACCATGATTGCCTCTTACTTCGGCCTGTGTGTCTGGCTC
GTCCCCTTTGCGCTCTTTGTTAGCTTGTCTGCCAGCGATAACGTCTTGCCCACCATGGGCAGCGAGCCAGTGCGT
GGCGTCGACGGCAAGAACAGGCATCAGGGCATGGTCAAGGCCGTCGTTGACAGTTCGCCGCTTCCCCTACCCCTT
ACTCGCCTTGCTTCGAAGATCGAGGCATTCGCACAAGCAGGAGCAGTGTTCCGCGAACTCTCACAGCCGCTTTCG
CTTACCATCGCCAGCCAGCTTTCCCAGACTGACGATGAGAAGGCGCCGGGATATGTGTTTTTCTTTTGGAAGAAG
CCAGGCAGCGGTTTATCCTCCGGCCGAGATGAAGCAGCCCCGTCCTGTGTGTGCGGCCTTGGACCTAAGATCTAT
GAATGCCGGCCATGGGGGACGGAAGCGTTGCCTGGTATTCAGACTTGGTAG
Gene >Ophio5|4534
ATGTGGATTCTGCCGCTCGTCGGCTACGCTGGCGCTCTCGTCGGCTTCTGCTTCCTGACGCTGGCCATCGCCTCC
GGGCTCTACTACCTGTCGGAGCTCGTCGAGGAACACACCGTCATAGCGAAGCGTCTCCTGACGCGCCTCATCTAC
ACCGTCGTCGGCCTGCAGATTTCTCTGTGGCTTCTGGACGGCTTCCCCTTCTGGTCGACCTTGCTGGGCATCGCT
GCTCACGGCGTCTACCTCGGCAACCTGAGGCGCTTCCCGTTTGTGAAGCTGTCAGATCCGCTCTTCCTGCTCGCA
TGTGGTAGGCACGGACTTGTTGCATACTGATTTGTGCTCTCGCTGATTCCGACGATGCCTTCAGTCCTCGTTCTT
GTCGATCACTATGTCTGGTTCAGACACTTTTCACACGGCCAGACGCGTGCCTACCAACGCTCGTCTTACTATGAC
GACGTCGACGTCCCAAGTTTTACCATGATTGCCTCTTACTTCGGCCTGTGTGTCTGGCTCGTCCCCTTTGCGCTC
TTTGTTAGCTTGTCTGCCAGCGATAACGTCTTGCCCACCATGGGCAGCGAGCCAGTGCGTGGCGTCGACGGCAAG
AACAGGCATCAGGGCATGGTCAAGGCCGTCGTTGACAGTGTTCGCGGCGCCATTGGCGATCTGGCCGGCTCCTGG
AATATGAATCGACCTTGATTGGATTCCACGAGTCAGTGCGAGGCGAACTCTCTAGTCGCCGCTTCCCCTACCCCT
TACTCGCCTTGCTTCGAAGATCGAGGCATTCGCACAAGCAGGAGCAGTGTGAGTCATGATCTTTCATCTTCTTCC
TCTGCCTATGATGAACCTCCATCACGCTAGATGGTATTTGACAAGGCTATGCCTTGGGTGATCATTTTTTGTCAT
AGTTACTCTGACAGGCTCTCCATTTCATCGACCTTGTTCCACGCGTTAGTCAAAATTAGGCTGACTCTGGCGCAG
GTTCCGCGAACTCTCACAGCCGCTTTCGCTTACCATCGCCAGCCAGCTTTCCCAGACTGACGATGAGAAGGCGCC
GGGATATGTGTTTTTCTTTTGGAAGAAGCCAGGCAGCGGTTTATCCTCCGGCCGAGATGAAGCAGCCCCGTCCTG
TGTGTGCGGCCTTGGACCTAAGATCTATGAATGCCGGCCATGGGGGACGGAAGCGTTGCCTGGTATTCAGACTTG
GTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail