Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4534
Gene name
Locationscaffold_36:43700..44904
Strand-
Gene length (bp)1204
Transcript length (bp)876
Coding sequence length (bp)873
Protein length (aa) 291

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04148 Erv26 Transmembrane adaptor Erv26 3.5E-88 1 192

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38869|SVP26_YEAST Protein SVP26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SVP26 PE=1 SV=1 3 193 7.0E-50
sp|Q1MTR8|SVP26_SCHPO Protein svp26 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=svp26 PE=3 SV=1 1 171 1.0E-38
sp|Q6UWH6|TX261_HUMAN Protein TEX261 OS=Homo sapiens GN=TEX261 PE=2 SV=1 1 197 3.0E-33
sp|Q5BJW3|TX261_RAT Protein TEX261 OS=Rattus norvegicus GN=Tex261 PE=2 SV=1 1 197 9.0E-33
sp|Q62302|TX261_MOUSE Protein TEX261 OS=Mus musculus GN=Tex261 PE=2 SV=1 1 197 9.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38869|SVP26_YEAST Protein SVP26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SVP26 PE=1 SV=1 3 193 7.0E-50
sp|Q1MTR8|SVP26_SCHPO Protein svp26 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=svp26 PE=3 SV=1 1 171 1.0E-38
sp|Q6UWH6|TX261_HUMAN Protein TEX261 OS=Homo sapiens GN=TEX261 PE=2 SV=1 1 197 3.0E-33
sp|Q5BJW3|TX261_RAT Protein TEX261 OS=Rattus norvegicus GN=Tex261 PE=2 SV=1 1 197 9.0E-33
sp|Q62302|TX261_MOUSE Protein TEX261 OS=Mus musculus GN=Tex261 PE=2 SV=1 1 197 9.0E-33
sp|Q5RFE0|TX261_PONAB Protein TEX261 OS=Pongo abelii GN=TEX261 PE=2 SV=1 1 197 7.0E-32
sp|Q58DA4|TX261_BOVIN Protein TEX261 OS=Bos taurus GN=TEX261 PE=2 SV=1 24 197 8.0E-29
sp|Q54ER8|TX261_DICDI Protein TEX261 homolog OS=Dictyostelium discoideum GN=DDB_G0291374 PE=3 SV=1 3 167 2.0E-22
[Show less]

GO

GO Term Description Terminal node
GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Yes
GO:0097020 COPII receptor activity Yes
GO:0016021 integral component of membrane Yes
GO:0008150 biological_process No
GO:0016192 vesicle-mediated transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0038024 cargo receptor activity No
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No
GO:0006810 transport No
GO:0048193 Golgi vesicle transport No
GO:0046907 intracellular transport No
GO:0051234 establishment of localization No
GO:0009987 cellular process No
GO:0051641 cellular localization No
GO:0051649 establishment of localization in cell No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 60 82 22
3 95 112 17
4 137 159 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4534
MWILPLVGYAGALVGFCFLTLAIASGLYYLSELVEEHTVIAKRLLTRLIYTVVGLQISLWLLDGFPFWSTLLGIA
AHGVYLGNLRRFPFVKLSDPLFLLACVLVLVDHYVWFRHFSHGQTRAYQRSSYYDDVDVPSFTMIASYFGLCVWL
VPFALFVSLSASDNVLPTMGSEPVRGVDGKNRHQGMVKAVVDSSPLPLPLTRLASKIEAFAQAGAVFRELSQPLS
LTIASQLSQTDDEKAPGYVFFFWKKPGSGLSSGRDEAAPSCVCGLGPKIYECRPWGTEALPGIQTW
Coding >Ophio5|4534
ATGTGGATTCTGCCGCTCGTCGGCTACGCTGGCGCTCTCGTCGGCTTCTGCTTCCTGACGCTGGCCATCGCCTCC
GGGCTCTACTACCTGTCGGAGCTCGTCGAGGAACACACCGTCATAGCGAAGCGTCTCCTGACGCGCCTCATCTAC
ACCGTCGTCGGCCTGCAGATTTCTCTGTGGCTTCTGGACGGCTTCCCCTTCTGGTCGACCTTGCTGGGCATCGCT
GCTCACGGCGTCTACCTCGGCAACCTGAGGCGCTTCCCGTTTGTGAAGCTGTCAGATCCGCTCTTCCTGCTCGCA
TGTGTCCTCGTTCTTGTCGATCACTATGTCTGGTTCAGACACTTTTCACACGGCCAGACGCGTGCCTACCAACGC
TCGTCTTACTATGACGACGTCGACGTCCCAAGTTTTACCATGATTGCCTCTTACTTCGGCCTGTGTGTCTGGCTC
GTCCCCTTTGCGCTCTTTGTTAGCTTGTCTGCCAGCGATAACGTCTTGCCCACCATGGGCAGCGAGCCAGTGCGT
GGCGTCGACGGCAAGAACAGGCATCAGGGCATGGTCAAGGCCGTCGTTGACAGTTCGCCGCTTCCCCTACCCCTT
ACTCGCCTTGCTTCGAAGATCGAGGCATTCGCACAAGCAGGAGCAGTGTTCCGCGAACTCTCACAGCCGCTTTCG
CTTACCATCGCCAGCCAGCTTTCCCAGACTGACGATGAGAAGGCGCCGGGATATGTGTTTTTCTTTTGGAAGAAG
CCAGGCAGCGGTTTATCCTCCGGCCGAGATGAAGCAGCCCCGTCCTGTGTGTGCGGCCTTGGACCTAAGATCTAT
GAATGCCGGCCATGGGGGACGGAAGCGTTGCCTGGTATTCAGACTTGG
Transcript >Ophio5|4534
ATGTGGATTCTGCCGCTCGTCGGCTACGCTGGCGCTCTCGTCGGCTTCTGCTTCCTGACGCTGGCCATCGCCTCC
GGGCTCTACTACCTGTCGGAGCTCGTCGAGGAACACACCGTCATAGCGAAGCGTCTCCTGACGCGCCTCATCTAC
ACCGTCGTCGGCCTGCAGATTTCTCTGTGGCTTCTGGACGGCTTCCCCTTCTGGTCGACCTTGCTGGGCATCGCT
GCTCACGGCGTCTACCTCGGCAACCTGAGGCGCTTCCCGTTTGTGAAGCTGTCAGATCCGCTCTTCCTGCTCGCA
TGTGTCCTCGTTCTTGTCGATCACTATGTCTGGTTCAGACACTTTTCACACGGCCAGACGCGTGCCTACCAACGC
TCGTCTTACTATGACGACGTCGACGTCCCAAGTTTTACCATGATTGCCTCTTACTTCGGCCTGTGTGTCTGGCTC
GTCCCCTTTGCGCTCTTTGTTAGCTTGTCTGCCAGCGATAACGTCTTGCCCACCATGGGCAGCGAGCCAGTGCGT
GGCGTCGACGGCAAGAACAGGCATCAGGGCATGGTCAAGGCCGTCGTTGACAGTTCGCCGCTTCCCCTACCCCTT
ACTCGCCTTGCTTCGAAGATCGAGGCATTCGCACAAGCAGGAGCAGTGTTCCGCGAACTCTCACAGCCGCTTTCG
CTTACCATCGCCAGCCAGCTTTCCCAGACTGACGATGAGAAGGCGCCGGGATATGTGTTTTTCTTTTGGAAGAAG
CCAGGCAGCGGTTTATCCTCCGGCCGAGATGAAGCAGCCCCGTCCTGTGTGTGCGGCCTTGGACCTAAGATCTAT
GAATGCCGGCCATGGGGGACGGAAGCGTTGCCTGGTATTCAGACTTGGTAG
Gene >Ophio5|4534
ATGTGGATTCTGCCGCTCGTCGGCTACGCTGGCGCTCTCGTCGGCTTCTGCTTCCTGACGCTGGCCATCGCCTCC
GGGCTCTACTACCTGTCGGAGCTCGTCGAGGAACACACCGTCATAGCGAAGCGTCTCCTGACGCGCCTCATCTAC
ACCGTCGTCGGCCTGCAGATTTCTCTGTGGCTTCTGGACGGCTTCCCCTTCTGGTCGACCTTGCTGGGCATCGCT
GCTCACGGCGTCTACCTCGGCAACCTGAGGCGCTTCCCGTTTGTGAAGCTGTCAGATCCGCTCTTCCTGCTCGCA
TGTGGTAGGCACGGACTTGTTGCATACTGATTTGTGCTCTCGCTGATTCCGACGATGCCTTCAGTCCTCGTTCTT
GTCGATCACTATGTCTGGTTCAGACACTTTTCACACGGCCAGACGCGTGCCTACCAACGCTCGTCTTACTATGAC
GACGTCGACGTCCCAAGTTTTACCATGATTGCCTCTTACTTCGGCCTGTGTGTCTGGCTCGTCCCCTTTGCGCTC
TTTGTTAGCTTGTCTGCCAGCGATAACGTCTTGCCCACCATGGGCAGCGAGCCAGTGCGTGGCGTCGACGGCAAG
AACAGGCATCAGGGCATGGTCAAGGCCGTCGTTGACAGTGTTCGCGGCGCCATTGGCGATCTGGCCGGCTCCTGG
AATATGAATCGACCTTGATTGGATTCCACGAGTCAGTGCGAGGCGAACTCTCTAGTCGCCGCTTCCCCTACCCCT
TACTCGCCTTGCTTCGAAGATCGAGGCATTCGCACAAGCAGGAGCAGTGTGAGTCATGATCTTTCATCTTCTTCC
TCTGCCTATGATGAACCTCCATCACGCTAGATGGTATTTGACAAGGCTATGCCTTGGGTGATCATTTTTTGTCAT
AGTTACTCTGACAGGCTCTCCATTTCATCGACCTTGTTCCACGCGTTAGTCAAAATTAGGCTGACTCTGGCGCAG
GTTCCGCGAACTCTCACAGCCGCTTTCGCTTACCATCGCCAGCCAGCTTTCCCAGACTGACGATGAGAAGGCGCC
GGGATATGTGTTTTTCTTTTGGAAGAAGCCAGGCAGCGGTTTATCCTCCGGCCGAGATGAAGCAGCCCCGTCCTG
TGTGTGCGGCCTTGGACCTAAGATCTATGAATGCCGGCCATGGGGGACGGAAGCGTTGCCTGGTATTCAGACTTG
GTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail