Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4529
Gene name
Locationscaffold_36:36829..38311
Strand-
Gene length (bp)1482
Transcript length (bp)1482
Coding sequence length (bp)1482
Protein length (aa) 494

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01545 Cation_efflux Cation efflux family 7.1E-22 204 395

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6Z7K5|MTP3_ORYSJ Metal tolerance protein 3 OS=Oryza sativa subsp. japonica GN=MTP3 PE=2 SV=1 179 485 7.0E-48
sp|Q5NA18|MTP5_ORYSJ Metal tolerance protein 5 OS=Oryza sativa subsp. japonica GN=MTP5 PE=2 SV=1 181 491 6.0E-46
sp|Q10PP8|MTP4_ORYSJ Metal tolerance protein 4 OS=Oryza sativa subsp. japonica GN=MTP4 PE=2 SV=1 147 477 1.0E-45
sp|Q9LDU0|MTP7_ORYSJ Metal tolerance protein 7 OS=Oryza sativa subsp. japonica GN=MTP7 PE=2 SV=1 176 477 7.0E-45
sp|Q9M2P2|MTPC3_ARATH Putative metal tolerance protein C3 OS=Arabidopsis thaliana GN=MTPC3 PE=3 SV=2 207 477 7.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6Z7K5|MTP3_ORYSJ Metal tolerance protein 3 OS=Oryza sativa subsp. japonica GN=MTP3 PE=2 SV=1 179 485 7.0E-48
sp|Q5NA18|MTP5_ORYSJ Metal tolerance protein 5 OS=Oryza sativa subsp. japonica GN=MTP5 PE=2 SV=1 181 491 6.0E-46
sp|Q10PP8|MTP4_ORYSJ Metal tolerance protein 4 OS=Oryza sativa subsp. japonica GN=MTP4 PE=2 SV=1 147 477 1.0E-45
sp|Q9LDU0|MTP7_ORYSJ Metal tolerance protein 7 OS=Oryza sativa subsp. japonica GN=MTP7 PE=2 SV=1 176 477 7.0E-45
sp|Q9M2P2|MTPC3_ARATH Putative metal tolerance protein C3 OS=Arabidopsis thaliana GN=MTPC3 PE=3 SV=2 207 477 7.0E-41
sp|Q9SAJ7|MTP9_ARATH Metal tolerance protein 9 OS=Arabidopsis thaliana GN=MTP9 PE=2 SV=2 183 477 6.0E-40
sp|Q0WU02|MTP10_ARATH Metal tolerance protein 10 OS=Arabidopsis thaliana GN=MTP10 PE=2 SV=1 175 477 8.0E-40
sp|O80632|MTP11_ARATH Metal tolerance protein 11 OS=Arabidopsis thaliana GN=MTP11 PE=2 SV=1 178 486 3.0E-37
sp|Q0DHJ5|MTP6_ORYSJ Metal tolerance protein 6 OS=Oryza sativa subsp. japonica GN=MTP6 PE=2 SV=2 181 486 1.0E-30
sp|A8GLB1|FIEF_SERP5 Cation-efflux pump FieF OS=Serratia proteamaculans (strain 568) GN=fieF PE=3 SV=1 215 484 6.0E-06
sp|A7MQ82|FIEF_CROS8 Cation-efflux pump FieF OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=fieF PE=3 SV=1 215 459 9.0E-06
sp|A8AL14|FIEF_CITK8 Cation-efflux pump FieF OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=fieF PE=3 SV=1 200 459 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0006812 cation transport Yes
GO:0008324 cation transmembrane transporter activity Yes
GO:0015075 ion transmembrane transporter activity No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No
GO:0022857 transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0009987 cellular process No
GO:0006811 ion transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

Domain # Start End Length
1 198 220 22
2 235 252 17
3 272 289 17
4 304 326 22
5 347 369 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4529
MVGKRSLRKDSSQALGHSSTRRRHRHHVDDMEDGMSACRRLLLRRRRRRHHQHHPSSLPGRFRDEDDDDDDEWEE
EDDRMTRANRRRDQLTQALLHGIDGDELERFRVPESQLKTMGNDKKAIREFYRAQNSCLDDWREVDAVVVALADD
VLDSMDPDPDGDGDQERCGALQRVQGNLAELLPDEERNRRAVAARRAAWAINFNVVANVLLLAGKAVAAVTTGSL
SLVASLVDSALDLLCTLIVWSTNRLVLWRLSALRRRFPVGRRRLEPVGILVFSIIMIISFLQILRESVSRLMPPH
RQPEALGVVAVVTMVATVVIKGAIGLACRPVRAPKVQALVQDCKTDVVFNSLSLLFPLVGHRAGIWWLDPLGAGL
LSLFIVYDWGCTSVDNVVRLSGEAVADDTLRKLTYLAWRFSPVVDGFKSIVAYHAGDGVWVEFDVLLGEDTPLGR
SHDIAETLQYCAEALPYVDRAFVTTDYAAVGPTGHALDTERNH*
Coding >Ophio5|4529
ATGGTCGGAAAGCGGTCTCTGCGAAAAGACAGCAGCCAGGCCTTAGGCCACAGCTCAACACGACGCCGTCACCGT
CACCACGTCGACGACATGGAAGATGGCATGTCGGCATGTCGTCGTCTTCTTCTTCGTCGTCGTCGTCGTCGTCAT
CATCAACATCATCCTTCTTCTCTTCCCGGCCGATTCCGAGACGAAGATGATGACGACGACGACGAGTGGGAGGAG
GAGGATGATCGAATGACGCGGGCGAATCGACGTCGTGATCAACTGACGCAGGCTCTCCTGCACGGCATCGACGGC
GACGAACTCGAACGTTTTCGCGTACCGGAATCGCAGCTCAAGACTATGGGTAATGATAAAAAAGCGATACGGGAA
TTTTATCGGGCGCAAAATTCCTGTCTCGATGATTGGCGTGAGGTTGACGCCGTCGTAGTCGCCTTGGCAGATGAC
GTGCTCGATTCCATGGATCCAGACCCGGATGGGGACGGCGATCAGGAACGCTGCGGCGCCTTGCAACGCGTTCAG
GGTAATCTGGCCGAGTTGTTACCGGACGAGGAGAGGAATCGTCGGGCGGTGGCGGCTCGGCGGGCGGCCTGGGCC
ATCAACTTCAACGTCGTCGCCAACGTATTGCTTCTGGCGGGAAAGGCCGTCGCCGCCGTCACCACCGGCTCCTTG
TCCTTGGTGGCTTCGCTCGTCGACTCGGCTCTCGACTTACTCTGTACCCTCATCGTCTGGTCCACCAATCGCCTC
GTGCTGTGGCGATTGAGTGCCCTGCGACGGAGGTTTCCTGTTGGCCGCCGGAGGCTGGAACCGGTCGGGATACTC
GTCTTCTCCATCATCATGATCATCTCCTTCTTACAGATCTTACGCGAGTCCGTCTCGCGTCTGATGCCTCCGCAT
CGCCAGCCGGAAGCCTTGGGCGTCGTCGCCGTCGTCACCATGGTGGCCACCGTTGTCATCAAGGGGGCCATCGGC
CTTGCCTGTCGCCCTGTGCGCGCCCCCAAGGTCCAGGCTCTGGTGCAGGATTGCAAGACGGATGTCGTCTTCAAC
TCCCTGTCCCTCTTGTTCCCCCTCGTCGGTCATCGTGCCGGTATATGGTGGTTGGATCCGCTCGGGGCCGGCCTG
CTTTCGCTCTTCATCGTCTACGACTGGGGCTGCACCTCGGTCGACAACGTCGTCCGCCTTTCCGGCGAGGCTGTC
GCCGACGACACGCTTCGTAAACTCACCTACCTGGCCTGGCGCTTCTCGCCCGTCGTCGACGGCTTCAAGTCCATC
GTCGCCTACCACGCCGGCGACGGTGTCTGGGTCGAGTTCGACGTCCTACTCGGCGAGGACACGCCTCTCGGTCGC
TCTCATGACATTGCCGAGACGCTGCAGTACTGCGCCGAGGCGCTGCCCTACGTCGACCGCGCCTTTGTCACCACT
GACTATGCCGCCGTCGGTCCCACGGGCCATGCACTCGATACCGAGCGCAATCACTGA
Transcript >Ophio5|4529
ATGGTCGGAAAGCGGTCTCTGCGAAAAGACAGCAGCCAGGCCTTAGGCCACAGCTCAACACGACGCCGTCACCGT
CACCACGTCGACGACATGGAAGATGGCATGTCGGCATGTCGTCGTCTTCTTCTTCGTCGTCGTCGTCGTCGTCAT
CATCAACATCATCCTTCTTCTCTTCCCGGCCGATTCCGAGACGAAGATGATGACGACGACGACGAGTGGGAGGAG
GAGGATGATCGAATGACGCGGGCGAATCGACGTCGTGATCAACTGACGCAGGCTCTCCTGCACGGCATCGACGGC
GACGAACTCGAACGTTTTCGCGTACCGGAATCGCAGCTCAAGACTATGGGTAATGATAAAAAAGCGATACGGGAA
TTTTATCGGGCGCAAAATTCCTGTCTCGATGATTGGCGTGAGGTTGACGCCGTCGTAGTCGCCTTGGCAGATGAC
GTGCTCGATTCCATGGATCCAGACCCGGATGGGGACGGCGATCAGGAACGCTGCGGCGCCTTGCAACGCGTTCAG
GGTAATCTGGCCGAGTTGTTACCGGACGAGGAGAGGAATCGTCGGGCGGTGGCGGCTCGGCGGGCGGCCTGGGCC
ATCAACTTCAACGTCGTCGCCAACGTATTGCTTCTGGCGGGAAAGGCCGTCGCCGCCGTCACCACCGGCTCCTTG
TCCTTGGTGGCTTCGCTCGTCGACTCGGCTCTCGACTTACTCTGTACCCTCATCGTCTGGTCCACCAATCGCCTC
GTGCTGTGGCGATTGAGTGCCCTGCGACGGAGGTTTCCTGTTGGCCGCCGGAGGCTGGAACCGGTCGGGATACTC
GTCTTCTCCATCATCATGATCATCTCCTTCTTACAGATCTTACGCGAGTCCGTCTCGCGTCTGATGCCTCCGCAT
CGCCAGCCGGAAGCCTTGGGCGTCGTCGCCGTCGTCACCATGGTGGCCACCGTTGTCATCAAGGGGGCCATCGGC
CTTGCCTGTCGCCCTGTGCGCGCCCCCAAGGTCCAGGCTCTGGTGCAGGATTGCAAGACGGATGTCGTCTTCAAC
TCCCTGTCCCTCTTGTTCCCCCTCGTCGGTCATCGTGCCGGTATATGGTGGTTGGATCCGCTCGGGGCCGGCCTG
CTTTCGCTCTTCATCGTCTACGACTGGGGCTGCACCTCGGTCGACAACGTCGTCCGCCTTTCCGGCGAGGCTGTC
GCCGACGACACGCTTCGTAAACTCACCTACCTGGCCTGGCGCTTCTCGCCCGTCGTCGACGGCTTCAAGTCCATC
GTCGCCTACCACGCCGGCGACGGTGTCTGGGTCGAGTTCGACGTCCTACTCGGCGAGGACACGCCTCTCGGTCGC
TCTCATGACATTGCCGAGACGCTGCAGTACTGCGCCGAGGCGCTGCCCTACGTCGACCGCGCCTTTGTCACCACT
GACTATGCCGCCGTCGGTCCCACGGGCCATGCACTCGATACCGAGCGCAATCACTGA
Gene >Ophio5|4529
ATGGTCGGAAAGCGGTCTCTGCGAAAAGACAGCAGCCAGGCCTTAGGCCACAGCTCAACACGACGCCGTCACCGT
CACCACGTCGACGACATGGAAGATGGCATGTCGGCATGTCGTCGTCTTCTTCTTCGTCGTCGTCGTCGTCGTCAT
CATCAACATCATCCTTCTTCTCTTCCCGGCCGATTCCGAGACGAAGATGATGACGACGACGACGAGTGGGAGGAG
GAGGATGATCGAATGACGCGGGCGAATCGACGTCGTGATCAACTGACGCAGGCTCTCCTGCACGGCATCGACGGC
GACGAACTCGAACGTTTTCGCGTACCGGAATCGCAGCTCAAGACTATGGGTAATGATAAAAAAGCGATACGGGAA
TTTTATCGGGCGCAAAATTCCTGTCTCGATGATTGGCGTGAGGTTGACGCCGTCGTAGTCGCCTTGGCAGATGAC
GTGCTCGATTCCATGGATCCAGACCCGGATGGGGACGGCGATCAGGAACGCTGCGGCGCCTTGCAACGCGTTCAG
GGTAATCTGGCCGAGTTGTTACCGGACGAGGAGAGGAATCGTCGGGCGGTGGCGGCTCGGCGGGCGGCCTGGGCC
ATCAACTTCAACGTCGTCGCCAACGTATTGCTTCTGGCGGGAAAGGCCGTCGCCGCCGTCACCACCGGCTCCTTG
TCCTTGGTGGCTTCGCTCGTCGACTCGGCTCTCGACTTACTCTGTACCCTCATCGTCTGGTCCACCAATCGCCTC
GTGCTGTGGCGATTGAGTGCCCTGCGACGGAGGTTTCCTGTTGGCCGCCGGAGGCTGGAACCGGTCGGGATACTC
GTCTTCTCCATCATCATGATCATCTCCTTCTTACAGATCTTACGCGAGTCCGTCTCGCGTCTGATGCCTCCGCAT
CGCCAGCCGGAAGCCTTGGGCGTCGTCGCCGTCGTCACCATGGTGGCCACCGTTGTCATCAAGGGGGCCATCGGC
CTTGCCTGTCGCCCTGTGCGCGCCCCCAAGGTCCAGGCTCTGGTGCAGGATTGCAAGACGGATGTCGTCTTCAAC
TCCCTGTCCCTCTTGTTCCCCCTCGTCGGTCATCGTGCCGGTATATGGTGGTTGGATCCGCTCGGGGCCGGCCTG
CTTTCGCTCTTCATCGTCTACGACTGGGGCTGCACCTCGGTCGACAACGTCGTCCGCCTTTCCGGCGAGGCTGTC
GCCGACGACACGCTTCGTAAACTCACCTACCTGGCCTGGCGCTTCTCGCCCGTCGTCGACGGCTTCAAGTCCATC
GTCGCCTACCACGCCGGCGACGGTGTCTGGGTCGAGTTCGACGTCCTACTCGGCGAGGACACGCCTCTCGGTCGC
TCTCATGACATTGCCGAGACGCTGCAGTACTGCGCCGAGGCGCTGCCCTACGTCGACCGCGCCTTTGTCACCACT
GACTATGCCGCCGTCGGTCCCACGGGCCATGCACTCGATACCGAGCGCAATCACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail