Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4528
Gene name
Locationscaffold_36:33471..36399
Strand+
Gene length (bp)2928
Transcript length (bp)2667
Coding sequence length (bp)2664
Protein length (aa) 888

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00488 MutS_V MutS domain V 8.5E-61 632 823
PF05192 MutS_III MutS domain III 8.8E-23 267 563
PF05188 MutS_II MutS domain II 2.1E-06 107 239

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O15457|MSH4_HUMAN MutS protein homolog 4 OS=Homo sapiens GN=MSH4 PE=1 SV=2 108 876 4.0E-135
sp|Q99MT2|MSH4_MOUSE MutS protein homolog 4 OS=Mus musculus GN=Msh4 PE=2 SV=1 73 876 5.0E-131
sp|P40965|MSH4_YEAST MutS protein homolog 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSH4 PE=1 SV=2 67 882 1.0E-123
sp|O94065|MSH4_CANAX MutS protein homolog 4 OS=Candida albicans GN=MSH4 PE=3 SV=1 122 886 9.0E-103
sp|F4JP48|MSH4_ARATH DNA mismatch repair protein MSH4 OS=Arabidopsis thaliana GN=MSH4 PE=2 SV=1 103 832 1.0E-96
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O15457|MSH4_HUMAN MutS protein homolog 4 OS=Homo sapiens GN=MSH4 PE=1 SV=2 108 876 4.0E-135
sp|Q99MT2|MSH4_MOUSE MutS protein homolog 4 OS=Mus musculus GN=Msh4 PE=2 SV=1 73 876 5.0E-131
sp|P40965|MSH4_YEAST MutS protein homolog 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSH4 PE=1 SV=2 67 882 1.0E-123
sp|O94065|MSH4_CANAX MutS protein homolog 4 OS=Candida albicans GN=MSH4 PE=3 SV=1 122 886 9.0E-103
sp|F4JP48|MSH4_ARATH DNA mismatch repair protein MSH4 OS=Arabidopsis thaliana GN=MSH4 PE=2 SV=1 103 832 1.0E-96
sp|Q23405|HIM14_CAEEL MutS protein homolog him-14 OS=Caenorhabditis elegans GN=him-14 PE=1 SV=2 107 848 1.0E-67
sp|Q46CE2|MUTS_METBF DNA mismatch repair protein MutS OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=mutS PE=3 SV=1 122 838 5.0E-62
sp|Q8RA71|MUTS_CALS4 DNA mismatch repair protein MutS OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=mutS PE=3 SV=1 121 827 2.0E-60
sp|Q8TTB4|MUTS_METAC DNA mismatch repair protein MutS OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=mutS PE=3 SV=1 123 825 2.0E-59
sp|A9KL10|MUTS_CLOPH DNA mismatch repair protein MutS OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=mutS PE=3 SV=1 123 823 7.0E-58
sp|B9MJU0|MUTS_CALBD DNA mismatch repair protein MutS OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=mutS PE=3 SV=1 82 888 1.0E-57
sp|Q12VC9|MUTS_METBU DNA mismatch repair protein MutS OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=mutS PE=3 SV=1 123 844 2.0E-57
sp|A5ILG0|MUTS_THEP1 DNA mismatch repair protein MutS OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=mutS PE=3 SV=1 88 839 4.0E-57
sp|A4XL47|MUTS_CALS8 DNA mismatch repair protein MutS OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=mutS PE=3 SV=1 82 842 4.0E-57
sp|Q0AYB5|MUTS_SYNWW DNA mismatch repair protein MutS OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=mutS PE=3 SV=1 105 828 4.0E-57
sp|Q8PWA7|MUTS_METMA DNA mismatch repair protein MutS OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=mutS PE=3 SV=1 123 838 5.0E-57
sp|A7HMG4|MUTS_FERNB DNA mismatch repair protein MutS OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=mutS PE=3 SV=1 82 819 1.0E-56
sp|A6TR79|MUTS_ALKMQ DNA mismatch repair protein MutS OS=Alkaliphilus metalliredigens (strain QYMF) GN=mutS PE=3 SV=1 117 842 5.0E-55
sp|A2RP10|MUTS_LACLM DNA mismatch repair protein MutS OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=mutS PE=3 SV=1 249 825 7.0E-55
sp|Q9CDK9|MUTS_LACLA DNA mismatch repair protein MutS OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=mutS PE=3 SV=1 249 825 9.0E-55
sp|Q24X61|MUTS_DESHY DNA mismatch repair protein MutS OS=Desulfitobacterium hafniense (strain Y51) GN=mutS PE=3 SV=1 231 832 1.0E-54
sp|Q9Z6W5|MUTS_CHLPN DNA mismatch repair protein MutS OS=Chlamydia pneumoniae GN=mutS PE=3 SV=2 259 823 1.0E-54
sp|B1LAW3|MUTS_THESQ DNA mismatch repair protein MutS OS=Thermotoga sp. (strain RQ2) GN=mutS PE=3 SV=1 88 839 1.0E-54
sp|P74926|MUTS_THEMA DNA mismatch repair protein MutS OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=mutS PE=3 SV=2 88 839 2.0E-54
sp|Q02VS3|MUTS_LACLS DNA mismatch repair protein MutS OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=mutS PE=3 SV=1 249 825 3.0E-54
sp|Q6MBV4|MUTS_PARUW DNA mismatch repair protein MutS OS=Protochlamydia amoebophila (strain UWE25) GN=mutS PE=3 SV=1 123 823 4.0E-54
sp|Q5L554|MUTS_CHLAB DNA mismatch repair protein MutS OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=mutS PE=3 SV=1 220 835 9.0E-54
sp|A9BJY3|MUTS_PETMO DNA mismatch repair protein MutS OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=mutS PE=3 SV=1 233 831 2.0E-53
sp|A3DDI3|MUTS_CLOTH DNA mismatch repair protein MutS OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=mutS PE=3 SV=1 123 831 3.0E-53
sp|A8MFD4|MUTS_ALKOO DNA mismatch repair protein MutS OS=Alkaliphilus oremlandii (strain OhILAs) GN=mutS PE=3 SV=2 123 832 5.0E-53
sp|A8AZU4|MUTS_STRGC DNA mismatch repair protein MutS OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=mutS PE=3 SV=1 249 834 5.0E-53
sp|B3E6P2|MUTS_GEOLS DNA mismatch repair protein MutS OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=mutS PE=3 SV=1 123 823 7.0E-53
sp|B2KB17|MUTS_ELUMP DNA mismatch repair protein MutS OS=Elusimicrobium minutum (strain Pei191) GN=mutS PE=3 SV=1 108 835 1.0E-52
sp|P61667|MUTS_GEOSL DNA mismatch repair protein MutS OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=mutS PE=3 SV=1 230 825 2.0E-52
sp|A0B976|MUTS_METTP DNA mismatch repair protein MutS OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=mutS PE=3 SV=1 221 831 2.0E-52
sp|Q39VR6|MUTS_GEOMG DNA mismatch repair protein MutS OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=mutS PE=3 SV=1 123 825 4.0E-52
sp|P61672|MUTS_TREDE DNA mismatch repair protein MutS OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=mutS PE=3 SV=1 249 837 4.0E-52
sp|Q7UP05|MUTS_RHOBA DNA mismatch repair protein MutS OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=mutS PE=3 SV=1 262 830 6.0E-52
sp|B2S1E1|MUTS_BORHD DNA mismatch repair protein MutS OS=Borrelia hermsii (strain HS1 / DAH) GN=mutS PE=3 SV=1 258 823 8.0E-52
sp|A6LLR1|MUTS_THEM4 DNA mismatch repair protein MutS OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=mutS PE=3 SV=1 125 819 9.0E-52
sp|Q255T1|MUTS_CHLFF DNA mismatch repair protein MutS OS=Chlamydophila felis (strain Fe/C-56) GN=mutS PE=3 SV=1 220 835 1.0E-51
sp|B8CX98|MUTS_HALOH DNA mismatch repair protein MutS OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=mutS PE=3 SV=1 249 850 1.0E-51
sp|B2G6E5|MUTS_LACRJ DNA mismatch repair protein MutS OS=Lactobacillus reuteri (strain JCM 1112) GN=mutS PE=3 SV=1 245 825 1.0E-51
sp|A5VIW9|MUTS_LACRD DNA mismatch repair protein MutS OS=Lactobacillus reuteri (strain DSM 20016) GN=mutS PE=3 SV=1 245 825 1.0E-51
sp|Q0STR4|MUTS_CLOPS DNA mismatch repair protein MutS OS=Clostridium perfringens (strain SM101 / Type A) GN=mutS PE=3 SV=1 260 823 2.0E-51
sp|Q821V6|MUTS_CHLCV DNA mismatch repair protein MutS OS=Chlamydophila caviae (strain GPIC) GN=mutS PE=3 SV=1 220 835 2.0E-51
sp|Q1IN52|MUTS_KORVE DNA mismatch repair protein MutS OS=Koribacter versatilis (strain Ellin345) GN=mutS PE=3 SV=1 95 821 2.0E-51
sp|Q187T6|MUTS_PEPD6 DNA mismatch repair protein MutS OS=Peptoclostridium difficile (strain 630) GN=mutS PE=3 SV=2 82 826 3.0E-51
sp|Q0TRD6|MUTS_CLOP1 DNA mismatch repair protein MutS OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=mutS PE=3 SV=1 260 823 4.0E-51
sp|Q8XL87|MUTS_CLOPE DNA mismatch repair protein MutS OS=Clostridium perfringens (strain 13 / Type A) GN=mutS PE=3 SV=1 260 823 7.0E-51
sp|Q2JIA6|MUTS_SYNJB DNA mismatch repair protein MutS OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=mutS PE=3 SV=1 260 819 1.0E-50
sp|Q1D5J6|MUTS_MYXXD DNA mismatch repair protein MutS OS=Myxococcus xanthus (strain DK 1622) GN=mutS PE=3 SV=1 247 888 1.0E-50
sp|Q67NK1|MUTS_SYMTH DNA mismatch repair protein MutS OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=mutS PE=3 SV=1 106 845 2.0E-50
sp|B8DFS4|MUTS_LISMH DNA mismatch repair protein MutS OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=mutS PE=3 SV=1 253 823 5.0E-50
sp|B2S2S5|MUTS_TREPS DNA mismatch repair protein MutS OS=Treponema pallidum subsp. pallidum (strain SS14) GN=mutS PE=3 SV=1 259 825 5.0E-50
sp|O83348|MUTS_TREPA DNA mismatch repair protein MutS OS=Treponema pallidum (strain Nichols) GN=mutS PE=3 SV=1 259 825 5.0E-50
sp|B3EP11|MUTS_CHLPB DNA mismatch repair protein MutS OS=Chlorobium phaeobacteroides (strain BS1) GN=mutS PE=3 SV=1 104 825 5.0E-50
sp|Q895H2|MUTS_CLOTE DNA mismatch repair protein MutS OS=Clostridium tetani (strain Massachusetts / E88) GN=mutS PE=3 SV=1 260 848 6.0E-50
sp|B0S1C1|MUTS_FINM2 DNA mismatch repair protein MutS OS=Finegoldia magna (strain ATCC 29328) GN=mutS PE=3 SV=1 82 825 6.0E-50
sp|B8FJL5|MUTS_DESAA DNA mismatch repair protein MutS OS=Desulfatibacillum alkenivorans (strain AK-01) GN=mutS PE=3 SV=1 105 828 8.0E-50
sp|B1I9E5|MUTS_STRPI DNA mismatch repair protein MutS OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=mutS PE=3 SV=1 253 834 1.0E-49
sp|C1CN23|MUTS_STRZP DNA mismatch repair protein MutS OS=Streptococcus pneumoniae (strain P1031) GN=mutS PE=3 SV=1 253 834 1.0E-49
sp|C1CH06|MUTS_STRZJ DNA mismatch repair protein MutS OS=Streptococcus pneumoniae (strain JJA) GN=mutS PE=3 SV=1 253 834 1.0E-49
sp|B8ZPK0|MUTS_STRPJ DNA mismatch repair protein MutS OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=mutS PE=3 SV=1 253 834 1.0E-49
sp|C1CAQ5|MUTS_STRP7 DNA mismatch repair protein MutS OS=Streptococcus pneumoniae (strain 70585) GN=mutS PE=3 SV=1 253 834 1.0E-49
sp|Q04I96|MUTS_STRP2 DNA mismatch repair protein MutS OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=mutS PE=3 SV=1 253 834 1.0E-49
sp|P0A3R4|HEXA_STRR6 DNA mismatch repair protein HexA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=hexA PE=3 SV=1 253 834 1.0E-49
sp|P0A3R3|HEXA_STRPN DNA mismatch repair protein HexA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=hexA PE=3 SV=1 253 834 1.0E-49
sp|C1L2V9|MUTS_LISMC DNA mismatch repair protein MutS OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=mutS PE=3 SV=1 253 823 1.0E-49
sp|Q0A8K3|MUTS_ALKEH DNA mismatch repair protein MutS OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=mutS PE=3 SV=1 248 839 1.0E-49
sp|A3CR17|MUTS_STRSV DNA mismatch repair protein MutS OS=Streptococcus sanguinis (strain SK36) GN=mutS PE=3 SV=1 219 823 1.0E-49
sp|Q71ZR7|MUTS_LISMF DNA mismatch repair protein MutS OS=Listeria monocytogenes serotype 4b (strain F2365) GN=mutS PE=3 SV=1 253 823 2.0E-49
sp|B8I2Q5|MUTS_CLOCE DNA mismatch repair protein MutS OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=mutS PE=3 SV=1 94 839 2.0E-49
sp|C1CTY2|MUTS_STRZT DNA mismatch repair protein MutS OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=mutS PE=3 SV=1 253 834 2.0E-49
sp|A0AIK5|MUTS_LISW6 DNA mismatch repair protein MutS OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=mutS PE=3 SV=1 253 823 2.0E-49
sp|Q8Y789|MUTS_LISMO DNA mismatch repair protein MutS OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=mutS PE=3 SV=1 253 823 3.0E-49
sp|Q97I19|MUTS_CLOAB DNA mismatch repair protein MutS OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=mutS PE=3 SV=1 260 838 3.0E-49
sp|C3KX35|MUTS_CLOB6 DNA mismatch repair protein MutS OS=Clostridium botulinum (strain 657 / Type Ba4) GN=mutS PE=3 SV=1 252 830 4.0E-49
sp|A1R0M2|MUTS_BORT9 DNA mismatch repair protein MutS OS=Borrelia turicatae (strain 91E135) GN=mutS PE=3 SV=1 256 823 5.0E-49
sp|Q92BV3|MUTS_LISIN DNA mismatch repair protein MutS OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=mutS PE=3 SV=1 253 823 5.0E-49
sp|A7GE45|MUTS_CLOBL DNA mismatch repair protein MutS OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=mutS PE=3 SV=1 252 830 6.0E-49
sp|C1FNT9|MUTS_CLOBJ DNA mismatch repair protein MutS OS=Clostridium botulinum (strain Kyoto / Type A2) GN=mutS PE=3 SV=1 252 830 7.0E-49
sp|Q3M892|MUTS_ANAVT DNA mismatch repair protein MutS OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=mutS PE=3 SV=1 123 825 8.0E-49
sp|A8F753|MUTS_PSELT DNA mismatch repair protein MutS OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=mutS PE=3 SV=1 82 819 8.0E-49
sp|Q3AQZ8|MUTS_CHLCH DNA mismatch repair protein MutS OS=Chlorobium chlorochromatii (strain CaD3) GN=mutS PE=3 SV=1 117 834 1.0E-48
sp|A4IXL2|MUTS_FRATW DNA mismatch repair protein MutS OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=mutS PE=3 SV=1 249 859 1.0E-48
sp|B2SEQ6|MUTS_FRATM DNA mismatch repair protein MutS OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=mutS PE=3 SV=1 249 859 1.0E-48
sp|B1KSA3|MUTS_CLOBM DNA mismatch repair protein MutS OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=mutS PE=3 SV=1 252 830 2.0E-48
sp|Q2A5B5|MUTS_FRATH DNA mismatch repair protein MutS OS=Francisella tularensis subsp. holarctica (strain LVS) GN=mutS PE=3 SV=1 249 859 2.0E-48
sp|A7N9Y6|MUTS_FRATF DNA mismatch repair protein MutS OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=mutS PE=3 SV=1 249 859 2.0E-48
sp|B1IM68|MUTS_CLOBK DNA mismatch repair protein MutS OS=Clostridium botulinum (strain Okra / Type B1) GN=mutS PE=3 SV=1 252 830 2.0E-48
sp|Q0BNM7|MUTS_FRATO DNA mismatch repair protein MutS OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=mutS PE=3 SV=1 249 859 3.0E-48
sp|C6DZZ3|MUTS_GEOSM DNA mismatch repair protein MutS OS=Geobacter sp. (strain M21) GN=mutS PE=3 SV=1 247 825 3.0E-48
sp|B7J0P3|MUTS_BORBZ DNA mismatch repair protein MutS OS=Borrelia burgdorferi (strain ZS7) GN=mutS PE=3 SV=1 262 823 4.0E-48
sp|O51737|MUTS_BORBU DNA mismatch repair protein MutS OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=mutS PE=3 SV=1 262 823 4.0E-48
sp|B9DW73|MUTS_STRU0 DNA mismatch repair protein MutS OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=mutS PE=3 SV=1 240 839 5.0E-48
sp|A1AMW9|MUTS_PELPD DNA mismatch repair protein MutS OS=Pelobacter propionicus (strain DSM 2379) GN=mutS PE=3 SV=1 104 823 5.0E-48
sp|A5D2K2|MUTS_PELTS DNA mismatch repair protein MutS OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=mutS PE=3 SV=1 255 843 6.0E-48
sp|A5EX62|MUTS_DICNV DNA mismatch repair protein MutS OS=Dichelobacter nodosus (strain VCS1703A) GN=mutS PE=3 SV=1 253 831 6.0E-48
sp|A4SFT1|MUTS_CHLPM DNA mismatch repair protein MutS OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=mutS PE=3 SV=1 117 825 7.0E-48
sp|Q01X96|MUTS_SOLUE DNA mismatch repair protein MutS OS=Solibacter usitatus (strain Ellin6076) GN=mutS PE=3 SV=1 249 826 7.0E-48
sp|Q8DWW1|MUTS_STRA5 DNA mismatch repair protein MutS OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=mutS PE=3 SV=1 249 823 8.0E-48
sp|Q8E2R3|MUTS_STRA3 DNA mismatch repair protein MutS OS=Streptococcus agalactiae serotype III (strain NEM316) GN=mutS PE=3 SV=1 249 823 8.0E-48
sp|A4W4J7|MUTS_STRS2 DNA mismatch repair protein MutS OS=Streptococcus suis (strain 98HAH33) GN=mutS PE=3 SV=1 232 823 8.0E-48
sp|Q5NEV8|MUTS_FRATT DNA mismatch repair protein MutS OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=mutS PE=3 SV=1 249 859 8.0E-48
sp|Q14GB1|MUTS_FRAT1 DNA mismatch repair protein MutS OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=mutS PE=3 SV=1 249 859 8.0E-48
sp|Q3JYM3|MUTS_STRA1 DNA mismatch repair protein MutS OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=mutS PE=3 SV=1 249 823 9.0E-48
sp|Q8NZ24|MUTS_STRP8 DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=mutS PE=3 SV=1 123 833 9.0E-48
sp|Q0SM54|MUTS_BORAP DNA mismatch repair protein MutS OS=Borrelia afzelii (strain PKo) GN=mutS PE=3 SV=1 262 830 1.0E-47
sp|B9DPB9|MUTS_STACT DNA mismatch repair protein MutS OS=Staphylococcus carnosus (strain TM300) GN=mutS PE=3 SV=1 260 817 1.0E-47
sp|B0TX99|MUTS_FRAP2 DNA mismatch repair protein MutS OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=mutS PE=3 SV=1 259 829 2.0E-47
sp|B5E385|MUTS_STRP4 DNA mismatch repair protein MutS OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=mutS PE=3 SV=1 253 834 2.0E-47
sp|C0MGC5|MUTS_STRS7 DNA mismatch repair protein MutS OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=mutS PE=3 SV=1 123 888 2.0E-47
sp|Q4L5Z9|MUTS_STAHJ DNA mismatch repair protein MutS OS=Staphylococcus haemolyticus (strain JCSC1435) GN=mutS PE=3 SV=1 260 842 2.0E-47
sp|Q9PLD0|MUTS_CHLMU DNA mismatch repair protein MutS OS=Chlamydia muridarum (strain MoPn / Nigg) GN=mutS PE=3 SV=1 107 819 2.0E-47
sp|O74773|MSH2_SCHPO DNA mismatch repair protein msh2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=msh2 PE=3 SV=2 122 823 2.0E-47
sp|B9EBI4|MUTS_MACCJ DNA mismatch repair protein MutS OS=Macrococcus caseolyticus (strain JCSC5402) GN=mutS PE=3 SV=1 253 840 2.0E-47
sp|A0L7L5|MUTS_MAGMM DNA mismatch repair protein MutS OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=mutS PE=3 SV=1 259 823 2.0E-47
sp|C0MAS5|MUTS_STRE4 DNA mismatch repair protein MutS OS=Streptococcus equi subsp. equi (strain 4047) GN=mutS PE=3 SV=1 229 888 2.0E-47
sp|A1BHN5|MUTS_CHLPD DNA mismatch repair protein MutS OS=Chlorobium phaeobacteroides (strain DSM 266) GN=mutS PE=3 SV=1 105 825 4.0E-47
sp|Q1JJH0|MUTS_STRPC DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=mutS PE=3 SV=1 123 833 4.0E-47
sp|Q1J9C1|MUTS_STRPB DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=mutS PE=3 SV=1 123 833 4.0E-47
sp|A5G447|MUTS_GEOUR DNA mismatch repair protein MutS OS=Geobacter uraniireducens (strain Rf4) GN=mutS PE=3 SV=1 220 825 4.0E-47
sp|A2RGX2|MUTS_STRPG DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=mutS PE=3 SV=1 123 833 5.0E-47
sp|Q5X9F3|MUTS_STRP6 DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=mutS PE=3 SV=1 123 833 5.0E-47
sp|B0VAU7|MUTS_ACIBY DNA mismatch repair protein MutS OS=Acinetobacter baumannii (strain AYE) GN=mutS PE=3 SV=1 248 841 5.0E-47
sp|B2HX50|MUTS_ACIBC DNA mismatch repair protein MutS OS=Acinetobacter baumannii (strain ACICU) GN=mutS PE=3 SV=1 248 841 5.0E-47
sp|B7IBV9|MUTS_ACIB5 DNA mismatch repair protein MutS OS=Acinetobacter baumannii (strain AB0057) GN=mutS PE=3 SV=1 248 841 5.0E-47
sp|B7GW85|MUTS_ACIB3 DNA mismatch repair protein MutS OS=Acinetobacter baumannii (strain AB307-0294) GN=mutS PE=3 SV=1 248 841 5.0E-47
sp|Q65ZX6|MUTS_BORBP DNA mismatch repair protein MutS OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=mutS PE=3 SV=1 262 823 5.0E-47
sp|B0VUC9|MUTS_ACIBS DNA mismatch repair protein MutS OS=Acinetobacter baumannii (strain SDF) GN=mutS PE=3 SV=1 248 841 6.0E-47
sp|Q48QT6|MUTS_STRPM DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=mutS PE=3 SV=1 123 833 6.0E-47
sp|Q31F87|MUTS_THICR DNA mismatch repair protein MutS OS=Thiomicrospira crunogena (strain XCL-2) GN=mutS PE=3 SV=1 198 834 7.0E-47
sp|Q5ZUJ3|MUTS_LEGPH DNA mismatch repair protein MutS OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=mutS PE=3 SV=2 248 827 7.0E-47
sp|A5ICW2|MUTS_LEGPC DNA mismatch repair protein MutS OS=Legionella pneumophila (strain Corby) GN=mutS PE=3 SV=2 248 827 7.0E-47
sp|Q6AQ04|MUTS_DESPS DNA mismatch repair protein MutS OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=mutS PE=3 SV=1 106 823 9.0E-47
sp|B0BAP7|MUTS_CHLTB DNA mismatch repair protein MutS OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=mutS PE=3 SV=1 123 819 1.0E-46
sp|B0B918|MUTS_CHLT2 DNA mismatch repair protein MutS OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=mutS PE=3 SV=1 123 819 1.0E-46
sp|Q2JT35|MUTS_SYNJA DNA mismatch repair protein MutS OS=Synechococcus sp. (strain JA-3-3Ab) GN=mutS PE=3 SV=1 105 819 1.0E-46
sp|A0Q0M6|MUTS_CLONN DNA mismatch repair protein MutS OS=Clostridium novyi (strain NT) GN=mutS PE=3 SV=1 249 835 1.0E-46
sp|Q1JEH0|MUTS_STRPD DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=mutS PE=3 SV=1 123 833 1.0E-46
sp|B5XJ75|MUTS_STRPZ DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=mutS PE=3 SV=1 123 833 1.0E-46
sp|B2V1M2|MUTS_CLOBA DNA mismatch repair protein MutS OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=mutS PE=3 SV=1 235 823 1.0E-46
sp|A6LWJ5|MUTS_CLOB8 DNA mismatch repair protein MutS OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=mutS PE=3 SV=1 235 819 2.0E-46
sp|Q5X4B2|MUTS_LEGPA DNA mismatch repair protein MutS OS=Legionella pneumophila (strain Paris) GN=mutS PE=3 SV=1 248 827 2.0E-46
sp|Q8RFK2|MUTS_FUSNN DNA mismatch repair protein MutS OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=mutS PE=3 SV=1 213 847 2.0E-46
sp|Q18FJ9|MUTS_HALWD DNA mismatch repair protein MutS OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=mutS PE=3 SV=1 527 818 2.0E-46
sp|P0DC61|MUTS_STRPQ DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=mutS PE=3 SV=1 123 833 2.0E-46
sp|P0DC60|MUTS_STRP3 DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=mutS PE=3 SV=1 123 833 2.0E-46
sp|Q8DRW8|MUTS_STRMU DNA mismatch repair protein MutS OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=mutS PE=3 SV=1 249 825 2.0E-46
sp|A5I2S2|MUTS_CLOBH DNA mismatch repair protein MutS OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=mutS PE=3 SV=1 252 830 2.0E-46
sp|A7FUL0|MUTS_CLOB1 DNA mismatch repair protein MutS OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=mutS PE=3 SV=1 252 830 2.0E-46
sp|P13705|MSH3_MOUSE DNA mismatch repair protein Msh3 OS=Mus musculus GN=Msh3 PE=2 SV=3 121 829 3.0E-46
sp|B3EEE1|MUTS_CHLL2 DNA mismatch repair protein MutS OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=mutS PE=3 SV=1 105 825 3.0E-46
sp|B8J008|MUTS_DESDA DNA mismatch repair protein MutS OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=mutS PE=3 SV=1 262 833 3.0E-46
sp|Q3JCL5|MUTS_NITOC DNA mismatch repair protein MutS OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=mutS PE=3 SV=1 249 818 3.0E-46
sp|P61668|MUTS_LACJO DNA mismatch repair protein MutS OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=mutS PE=3 SV=1 255 825 3.0E-46
sp|B3W9W4|MUTS_LACCB DNA mismatch repair protein MutS OS=Lactobacillus casei (strain BL23) GN=mutS PE=3 SV=1 208 823 4.0E-46
sp|Q035Z2|MUTS_LACC3 DNA mismatch repair protein MutS OS=Lactobacillus casei (strain ATCC 334) GN=mutS PE=3 SV=1 208 823 4.0E-46
sp|Q99XL8|MUTS_STRP1 DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M1 GN=mutS PE=3 SV=1 123 833 4.0E-46
sp|C5D9H5|MUTS_GEOSW DNA mismatch repair protein MutS OS=Geobacillus sp. (strain WCH70) GN=mutS PE=3 SV=1 534 834 6.0E-46
sp|Q2RJG2|MUTS_MOOTA DNA mismatch repair protein MutS OS=Moorella thermoacetica (strain ATCC 39073) GN=mutS PE=3 SV=1 262 819 6.0E-46
sp|Q65JE2|MUTS_BACLD DNA mismatch repair protein MutS OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=mutS PE=3 SV=1 249 834 7.0E-46
sp|P20585|MSH3_HUMAN DNA mismatch repair protein Msh3 OS=Homo sapiens GN=MSH3 PE=1 SV=4 228 823 7.0E-46
sp|B2GB17|MUTS_LACF3 DNA mismatch repair protein MutS OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=mutS PE=3 SV=1 253 823 7.0E-46
sp|Q1H2P1|MUTS_METFK DNA mismatch repair protein MutS OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=mutS1 PE=3 SV=1 107 818 8.0E-46
sp|O84797|MUTS_CHLTR DNA mismatch repair protein MutS OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=mutS PE=3 SV=1 123 819 1.0E-45
sp|P26359|MSH3_SCHPO DNA mismatch repair protein msh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=msh3 PE=3 SV=1 214 848 1.0E-45
sp|Q1J489|MUTS_STRPF DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=mutS PE=3 SV=1 123 833 1.0E-45
sp|Q3KKQ0|MUTS_CHLTA DNA mismatch repair protein MutS OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=mutS PE=3 SV=1 123 819 1.0E-45
sp|Q5WVP6|MUTS_LEGPL DNA mismatch repair protein MutS OS=Legionella pneumophila (strain Lens) GN=mutS PE=3 SV=1 248 827 2.0E-45
sp|Q11YS6|MUTS_CYTH3 DNA mismatch repair protein MutS OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=mutS PE=3 SV=1 121 859 2.0E-45
sp|Q045Q5|MUTS_LACGA DNA mismatch repair protein MutS OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=mutS PE=3 SV=1 255 825 2.0E-45
sp|B2TIC3|MUTS_CLOBB DNA mismatch repair protein MutS OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=mutS PE=3 SV=1 235 823 2.0E-45
sp|P73769|MUTS_SYNY3 DNA mismatch repair protein MutS OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=mutS PE=3 SV=2 260 825 2.0E-45
sp|A0Q809|MUTS_FRATN DNA mismatch repair protein MutS OS=Francisella tularensis subsp. novicida (strain U112) GN=mutS PE=3 SV=1 249 859 2.0E-45
sp|B9K800|MUTS_THENN DNA mismatch repair protein MutS OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=mutS PE=3 SV=1 531 832 2.0E-45
sp|Q3ACA5|MUTS_CARHZ DNA mismatch repair protein MutS OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=mutS PE=3 SV=1 202 819 2.0E-45
sp|C3LS25|MUTS_VIBCM DNA mismatch repair protein MutS OS=Vibrio cholerae serotype O1 (strain M66-2) GN=mutS PE=3 SV=1 227 838 5.0E-45
sp|Q9KUI6|MUTS_VIBCH DNA mismatch repair protein MutS OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=mutS PE=3 SV=1 227 838 5.0E-45
sp|A5F9C4|MUTS_VIBC3 DNA mismatch repair protein MutS OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=mutS PE=3 SV=1 227 838 5.0E-45
sp|B7VK59|MUTS_VIBTL DNA mismatch repair protein MutS OS=Vibrio tasmaniensis (strain LGP32) GN=mutS PE=3 SV=1 217 816 5.0E-45
sp|Q2FYZ9|MUTS_STAA8 DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain NCTC 8325) GN=mutS PE=3 SV=2 217 817 5.0E-45
sp|P65494|MUTS_STAAW DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain MW2) GN=mutS PE=3 SV=1 217 817 5.0E-45
sp|P0C1S1|MUTS_STAAU DNA mismatch repair protein MutS OS=Staphylococcus aureus GN=mutS PE=3 SV=1 217 817 5.0E-45
sp|A8Z1W6|MUTS_STAAT DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=mutS PE=3 SV=1 217 817 5.0E-45
sp|Q6G9R8|MUTS_STAAS DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain MSSA476) GN=mutS PE=3 SV=1 217 817 5.0E-45
sp|P65493|MUTS_STAAN DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain N315) GN=mutS PE=3 SV=1 217 817 5.0E-45
sp|Q931S8|MUTS_STAAM DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=mutS PE=3 SV=2 217 817 5.0E-45
sp|A6QGJ4|MUTS_STAAE DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain Newman) GN=mutS PE=3 SV=1 217 817 5.0E-45
sp|Q5HGD6|MUTS_STAAC DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain COL) GN=mutS PE=3 SV=1 217 817 5.0E-45
sp|A5ISH9|MUTS_STAA9 DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain JH9) GN=mutS PE=3 SV=1 217 817 5.0E-45
sp|A6U1B4|MUTS_STAA2 DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain JH1) GN=mutS PE=3 SV=1 217 817 5.0E-45
sp|A7X1T6|MUTS_STAA1 DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=mutS PE=3 SV=1 217 817 5.0E-45
sp|P61671|MUTS_THET2 DNA mismatch repair protein MutS OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=mutS PE=3 SV=1 267 828 7.0E-45
sp|P25847|MSH2_YEAST DNA mismatch repair protein MSH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSH2 PE=1 SV=2 122 878 9.0E-45
sp|O24617|MSH2_ARATH DNA mismatch repair protein MSH2 OS=Arabidopsis thaliana GN=MSH2 PE=1 SV=1 122 823 9.0E-45
sp|A9KG24|MUTS_COXBN DNA mismatch repair protein MutS OS=Coxiella burnetii (strain Dugway 5J108-111) GN=mutS PE=3 SV=1 227 823 9.0E-45
sp|Q5HBQ7|MUTS_EHRRW DNA mismatch repair protein MutS OS=Ehrlichia ruminantium (strain Welgevonden) GN=mutS PE=3 SV=1 260 828 9.0E-45
sp|Q2LUL3|MUTS_SYNAS DNA mismatch repair protein MutS OS=Syntrophus aciditrophicus (strain SB) GN=mutS PE=3 SV=1 122 825 1.0E-44
sp|Q56239|MUTS_THET8 DNA mismatch repair protein MutS OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=mutS PE=1 SV=3 267 828 1.0E-44
sp|A8ZXH5|MUTS_DESOH DNA mismatch repair protein MutS OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=mutS PE=3 SV=1 97 819 1.0E-44
sp|Q5FHE8|MUTS_EHRRG DNA mismatch repair protein MutS OS=Ehrlichia ruminantium (strain Gardel) GN=mutS PE=3 SV=1 260 828 1.0E-44
sp|Q6GHE0|MUTS_STAAR DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain MRSA252) GN=mutS PE=3 SV=1 217 819 1.0E-44
sp|A7Z4X5|MUTS_BACMF DNA mismatch repair protein MutS OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=mutS PE=3 SV=1 259 826 1.0E-44
sp|Q03MY4|MUTS_STRTD DNA mismatch repair protein MutS OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=mutS PE=3 SV=1 249 823 1.0E-44
sp|Q5M1Z0|MUTS_STRT1 DNA mismatch repair protein MutS OS=Streptococcus thermophilus (strain CNRZ 1066) GN=mutS PE=3 SV=1 249 823 1.0E-44
sp|Q5M6I1|MUTS_STRT2 DNA mismatch repair protein MutS OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=mutS PE=3 SV=1 249 823 1.0E-44
sp|Q30ZX3|MUTS_DESAG DNA mismatch repair protein MutS OS=Desulfovibrio alaskensis (strain G20) GN=mutS PE=3 SV=1 123 838 2.0E-44
sp|Q83CQ2|MUTS_COXBU DNA mismatch repair protein MutS OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=mutS PE=3 SV=1 227 823 2.0E-44
sp|Q6FC54|MUTS_ACIAD DNA mismatch repair protein MutS OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=mutS PE=3 SV=1 248 841 2.0E-44
sp|B6ENH6|MUTS_ALISL DNA mismatch repair protein MutS OS=Aliivibrio salmonicida (strain LFI1238) GN=mutS PE=3 SV=1 226 823 2.0E-44
sp|A3QC86|MUTS_SHELP DNA mismatch repair protein MutS OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=mutS PE=3 SV=1 260 829 2.0E-44
sp|A9NCN3|MUTS_COXBR DNA mismatch repair protein MutS OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=mutS PE=3 SV=1 227 823 3.0E-44
sp|Q2S254|MUTS_SALRD DNA mismatch repair protein MutS OS=Salinibacter ruber (strain DSM 13855 / M31) GN=mutS PE=3 SV=1 104 823 3.0E-44
sp|Q048Y4|MUTS_LACDB DNA mismatch repair protein MutS OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=mutS PE=3 SV=1 270 838 3.0E-44
sp|Q5XXB5|MSH2_CHLAE DNA mismatch repair protein Msh2 OS=Chlorocebus aethiops GN=MSH2 PE=2 SV=1 262 823 3.0E-44
sp|Q3IUH3|MUTS_NATPD DNA mismatch repair protein MutS OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=mutS PE=3 SV=1 254 824 3.0E-44
sp|Q2YXR9|MUTS_STAAB DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=mutS PE=3 SV=1 217 817 3.0E-44
sp|P43246|MSH2_HUMAN DNA mismatch repair protein Msh2 OS=Homo sapiens GN=MSH2 PE=1 SV=1 262 823 3.0E-44
sp|Q10YG4|MUTS_TRIEI DNA mismatch repair protein MutS OS=Trichodesmium erythraeum (strain IMS101) GN=mutS PE=3 SV=1 123 823 5.0E-44
sp|Q7MHR2|MUTS_VIBVY DNA mismatch repair protein MutS OS=Vibrio vulnificus (strain YJ016) GN=mutS PE=3 SV=2 217 832 6.0E-44
sp|Q9ZIX6|MUTS_THECA DNA mismatch repair protein MutS OS=Thermus caldophilus GN=mutS PE=3 SV=1 267 828 6.0E-44
sp|Q8DC53|MUTS_VIBVU DNA mismatch repair protein MutS OS=Vibrio vulnificus (strain CMCP6) GN=mutS PE=3 SV=2 217 832 7.0E-44
sp|Q47WN0|MUTS_COLP3 DNA mismatch repair protein MutS OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=mutS PE=3 SV=1 82 818 7.0E-44
sp|A6W1Q6|MUTS_MARMS DNA mismatch repair protein MutS OS=Marinomonas sp. (strain MWYL1) GN=mutS PE=3 SV=1 104 823 7.0E-44
sp|Q88UZ7|MUTS_LACPL DNA mismatch repair protein MutS OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=mutS PE=3 SV=1 539 825 8.0E-44
sp|B5FAC8|MUTS_VIBFM DNA mismatch repair protein MutS OS=Vibrio fischeri (strain MJ11) GN=mutS PE=3 SV=1 226 823 9.0E-44
sp|P25336|MSH3_YEAST DNA mismatch repair protein MSH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSH3 PE=1 SV=2 68 825 1.0E-43
sp|A6ZTR3|MSH3_YEAS7 DNA mismatch repair protein MSH3 OS=Saccharomyces cerevisiae (strain YJM789) GN=MSH3 PE=3 SV=2 68 825 1.0E-43
sp|O66652|MUTS_AQUAE DNA mismatch repair protein MutS OS=Aquifex aeolicus (strain VF5) GN=mutS PE=3 SV=1 259 821 1.0E-43
sp|P49849|MUTS_BACSU DNA mismatch repair protein MutS OS=Bacillus subtilis (strain 168) GN=mutS PE=3 SV=3 259 826 1.0E-43
sp|Q3IDC8|MUTS_PSEHT DNA mismatch repair protein MutS OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=mutS PE=3 SV=1 94 823 2.0E-43
sp|A6LG92|MUTS_PARD8 DNA mismatch repair protein MutS OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=mutS PE=3 SV=1 227 834 2.0E-43
sp|Q5FLX5|MUTS_LACAC DNA mismatch repair protein MutS OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=mutS PE=3 SV=1 270 842 2.0E-43
sp|Q5L7B7|MUTS_BACFN DNA mismatch repair protein MutS OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=mutS PE=3 SV=1 227 823 2.0E-43
sp|A1VDD9|MUTS_DESVV DNA mismatch repair protein MutS OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=mutS PE=3 SV=1 535 836 3.0E-43
sp|Q0HL63|MUTS_SHESM DNA mismatch repair protein MutS OS=Shewanella sp. (strain MR-4) GN=mutS PE=3 SV=1 260 818 3.0E-43
sp|Q64MG7|MUTS_BACFR DNA mismatch repair protein MutS OS=Bacteroides fragilis (strain YCH46) GN=mutS PE=3 SV=1 227 823 3.0E-43
sp|P61666|MUTS_DESVH DNA mismatch repair protein MutS OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=mutS PE=3 SV=1 535 836 3.0E-43
sp|Q5E7G7|MUTS_VIBF1 DNA mismatch repair protein MutS OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=mutS PE=3 SV=2 226 823 3.0E-43
sp|A7GR99|MUTS_BACCN DNA mismatch repair protein MutS OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=mutS PE=3 SV=1 262 828 3.0E-43
sp|Q1G938|MUTS_LACDA DNA mismatch repair protein MutS OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=mutS PE=3 SV=1 270 838 4.0E-43
sp|Q1QZX5|MUTS_CHRSD DNA mismatch repair protein MutS OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=mutS PE=3 SV=1 123 823 4.0E-43
sp|A2R1F6|MSH3_ASPNC DNA mismatch repair protein msh3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=msh3 PE=3 SV=2 222 823 4.0E-43
sp|Q0IE05|MUTS_SYNS3 DNA mismatch repair protein MutS OS=Synechococcus sp. (strain CC9311) GN=mutS PE=3 SV=1 260 823 4.0E-43
sp|A4IMI0|MUTS_GEOTN DNA mismatch repair protein MutS OS=Geobacillus thermodenitrificans (strain NG80-2) GN=mutS PE=3 SV=1 537 826 5.0E-43
sp|Q9XGC9|MSH2_MAIZE DNA mismatch repair protein MSH2 OS=Zea mays GN=MUS1 PE=3 SV=1 262 823 5.0E-43
sp|Q56215|MUTS_THEAQ DNA mismatch repair protein MutS OS=Thermus aquaticus GN=mutS PE=1 SV=1 262 828 6.0E-43
sp|Q3IYI5|MUTS_RHOS4 DNA mismatch repair protein MutS OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=mutS PE=3 SV=1 261 830 6.0E-43
sp|B0JFY0|MUTS_MICAN DNA mismatch repair protein MutS OS=Microcystis aeruginosa (strain NIES-843) GN=mutS PE=3 SV=1 262 825 7.0E-43
sp|Q8EBR9|MUTS_SHEON DNA mismatch repair protein MutS OS=Shewanella oneidensis (strain MR-1) GN=mutS PE=3 SV=1 260 818 9.0E-43
sp|Q8A334|MUTS_BACTN DNA mismatch repair protein MutS OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=mutS PE=3 SV=1 264 823 9.0E-43
sp|A9KYG1|MUTS_SHEB9 DNA mismatch repair protein MutS OS=Shewanella baltica (strain OS195) GN=mutS PE=3 SV=1 260 823 9.0E-43
sp|Q9HSM2|MUTS1_HALSA DNA mismatch repair protein MutS 1 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=mutS1 PE=3 SV=1 549 830 1.0E-42
sp|B0R2T0|MUTS1_HALS3 DNA mismatch repair protein MutS 1 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=mutS1 PE=3 SV=1 549 830 1.0E-42
sp|Q2GJL7|MUTS_ANAPZ DNA mismatch repair protein MutS OS=Anaplasma phagocytophilum (strain HZ) GN=mutS PE=3 SV=1 254 817 1.0E-42
sp|A1U2E8|MUTS_MARHV DNA mismatch repair protein MutS OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=mutS PE=3 SV=1 227 817 1.0E-42
sp|Q086A1|MUTS_SHEFN DNA mismatch repair protein MutS OS=Shewanella frigidimarina (strain NCIMB 400) GN=mutS PE=3 SV=1 253 818 1.0E-42
sp|C0QFS1|MUTS_DESAH DNA mismatch repair protein MutS OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=mutS PE=3 SV=1 262 826 2.0E-42
sp|C0QPF0|MUTS_PERMH DNA mismatch repair protein MutS OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=mutS PE=3 SV=1 259 830 2.0E-42
sp|A1T004|MUTS_PSYIN DNA mismatch repair protein MutS OS=Psychromonas ingrahamii (strain 37) GN=mutS PE=3 SV=1 105 823 2.0E-42
sp|Q3YSJ8|MUTS_EHRCJ DNA mismatch repair protein MutS OS=Ehrlichia canis (strain Jake) GN=mutS PE=3 SV=1 260 828 2.0E-42
sp|Q82ZA2|MUTS_ENTFA DNA mismatch repair protein MutS OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=mutS PE=3 SV=1 549 823 2.0E-42
sp|Q5L0E5|MUTS_GEOKA DNA mismatch repair protein MutS OS=Geobacillus kaustophilus (strain HTA426) GN=mutS PE=3 SV=1 537 825 2.0E-42
sp|A0KU91|MUTS_SHESA DNA mismatch repair protein MutS OS=Shewanella sp. (strain ANA-3) GN=mutS PE=3 SV=1 260 818 2.0E-42
sp|Q9HSL6|MUTS2_HALSA DNA mismatch repair protein MutS 2 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=mutS2 PE=3 SV=1 95 819 2.0E-42
sp|B0R2T7|MUTS2_HALS3 DNA mismatch repair protein MutS 2 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=mutS2 PE=3 SV=1 95 819 2.0E-42
sp|B3H2J9|MUTS_ACTP7 DNA mismatch repair protein MutS OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=mutS PE=3 SV=1 94 836 2.0E-42
sp|A1CDD4|MSH3_ASPCL DNA mismatch repair protein msh3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=msh3 PE=3 SV=1 258 817 2.0E-42
sp|A5UZK7|MUTS_ROSS1 DNA mismatch repair protein MutS OS=Roseiflexus sp. (strain RS-1) GN=mutS PE=3 SV=1 542 825 2.0E-42
sp|Q4WGB7|MSH3_ASPFU DNA mismatch repair protein msh3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=msh3 PE=3 SV=1 262 818 2.0E-42
sp|B0YCF6|MSH3_ASPFC DNA mismatch repair protein msh3 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=msh3 PE=3 SV=1 262 818 2.0E-42
sp|B2J434|MUTS_NOSP7 DNA mismatch repair protein MutS OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=mutS PE=3 SV=1 123 825 3.0E-42
sp|Q16D05|MUTS_ROSDO DNA mismatch repair protein MutS OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=mutS PE=3 SV=1 261 830 3.0E-42
sp|Q87LQ9|MUTS_VIBPA DNA mismatch repair protein MutS OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=mutS PE=3 SV=1 227 838 3.0E-42
sp|O13396|MSH2_NEUCR DNA mismatch repair protein msh-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=msh-2 PE=3 SV=1 544 823 3.0E-42
sp|A4VJN9|MUTS_PSEU5 DNA mismatch repair protein MutS OS=Pseudomonas stutzeri (strain A1501) GN=mutS PE=3 SV=2 248 816 4.0E-42
sp|Q1MRT4|MUTS_LAWIP DNA mismatch repair protein MutS OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=mutS PE=3 SV=1 213 831 5.0E-42
sp|A9VS13|MUTS_BACWK DNA mismatch repair protein MutS OS=Bacillus weihenstephanensis (strain KBAB4) GN=mutS PE=3 SV=1 262 828 6.0E-42
sp|Q0CPP9|MSH3_ASPTN DNA mismatch repair protein msh3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=msh3 PE=3 SV=1 258 827 6.0E-42
sp|Q0HXG1|MUTS_SHESR DNA mismatch repair protein MutS OS=Shewanella sp. (strain MR-7) GN=mutS PE=3 SV=1 260 818 6.0E-42
sp|B0T142|MUTS_CAUSK DNA mismatch repair protein MutS OS=Caulobacter sp. (strain K31) GN=mutS PE=3 SV=1 250 865 6.0E-42
sp|A6WR19|MUTS_SHEB8 DNA mismatch repair protein MutS OS=Shewanella baltica (strain OS185) GN=mutS PE=3 SV=1 260 823 6.0E-42
sp|A7NPT5|MUTS_ROSCS DNA mismatch repair protein MutS OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=mutS PE=3 SV=1 535 825 7.0E-42
sp|B8E8U0|MUTS_SHEB2 DNA mismatch repair protein MutS OS=Shewanella baltica (strain OS223) GN=mutS PE=3 SV=1 260 823 7.0E-42
sp|Q6BW83|MSH3_DEBHA DNA mismatch repair protein MSH3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MSH3 PE=3 SV=2 104 828 7.0E-42
sp|Q28VY6|MUTS_JANSC DNA mismatch repair protein MutS OS=Jannaschia sp. (strain CCS1) GN=mutS PE=3 SV=1 254 830 9.0E-42
sp|A6WV86|MUTS_OCHA4 DNA mismatch repair protein MutS OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=mutS PE=3 SV=1 105 840 9.0E-42
sp|C5BMR5|MUTS_TERTT DNA mismatch repair protein MutS OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=mutS PE=3 SV=1 259 837 1.0E-41
sp|A9ILT1|MUTS_BART1 DNA mismatch repair protein MutS OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=mutS PE=3 SV=1 226 840 1.0E-41
sp|A1RHG2|MUTS_SHESW DNA mismatch repair protein MutS OS=Shewanella sp. (strain W3-18-1) GN=mutS PE=3 SV=1 260 823 1.0E-41
sp|A4Y934|MUTS_SHEPC DNA mismatch repair protein MutS OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=mutS PE=3 SV=1 260 823 1.0E-41
sp|Q12PY3|MUTS_SHEDO DNA mismatch repair protein MutS OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=mutS PE=3 SV=1 253 836 1.0E-41
sp|P43247|MSH2_MOUSE DNA mismatch repair protein Msh2 OS=Mus musculus GN=Msh2 PE=1 SV=1 499 879 1.0E-41
sp|A5FJ63|MUTS_FLAJ1 DNA mismatch repair protein MutS OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=mutS PE=3 SV=2 121 827 1.0E-41
sp|Q3MHE4|MSH2_BOVIN DNA mismatch repair protein Msh2 OS=Bos taurus GN=MSH2 PE=2 SV=1 510 823 1.0E-41
sp|A8YTH9|MUTS_LACH4 DNA mismatch repair protein MutS OS=Lactobacillus helveticus (strain DPC 4571) GN=mutS PE=3 SV=1 270 842 2.0E-41
sp|A5VN83|MUTS_BRUO2 DNA mismatch repair protein MutS OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=mutS PE=3 SV=1 105 840 2.0E-41
sp|A3PNR5|MUTS_RHOS1 DNA mismatch repair protein MutS OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=mutS PE=3 SV=1 261 830 2.0E-41
sp|Q8CXG6|MUTS_OCEIH DNA mismatch repair protein MutS OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=mutS PE=3 SV=1 262 823 2.0E-41
sp|Q98C21|MUTS_RHILO DNA mismatch repair protein MutS OS=Rhizobium loti (strain MAFF303099) GN=mutS PE=3 SV=1 228 840 2.0E-41
sp|A8EZG1|MUTS_RICCK DNA mismatch repair protein MutS OS=Rickettsia canadensis (strain McKiel) GN=mutS PE=3 SV=1 228 826 2.0E-41
sp|B9IV59|MUTS_BACCQ DNA mismatch repair protein MutS OS=Bacillus cereus (strain Q1) GN=mutS PE=3 SV=1 262 828 2.0E-41
sp|P61665|MUTS_BACC1 DNA mismatch repair protein MutS OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=mutS PE=3 SV=1 262 828 2.0E-41
sp|Q636Q7|MUTS_BACCZ DNA mismatch repair protein MutS OS=Bacillus cereus (strain ZK / E33L) GN=mutS PE=3 SV=1 262 828 3.0E-41
sp|A8GMX2|MUTS_RICAH DNA mismatch repair protein MutS OS=Rickettsia akari (strain Hartford) GN=mutS PE=3 SV=1 228 839 3.0E-41
sp|Q3ZYA0|MUTS_DEHMC DNA mismatch repair protein MutS OS=Dehalococcoides mccartyi (strain CBDB1) GN=mutS PE=3 SV=1 227 823 3.0E-41
sp|Q8CPF0|MUTS_STAES DNA mismatch repair protein MutS OS=Staphylococcus epidermidis (strain ATCC 12228) GN=mutS PE=3 SV=1 535 825 3.0E-41
sp|Q5HPP5|MUTS_STAEQ DNA mismatch repair protein MutS OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=mutS PE=3 SV=1 535 825 3.0E-41
sp|Q8UIF2|MUTS_AGRFC DNA mismatch repair protein MutS OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=mutS PE=3 SV=1 261 823 3.0E-41
sp|Q9KAC0|MUTS_BACHD DNA mismatch repair protein MutS OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=mutS PE=3 SV=1 534 828 3.0E-41
sp|Q21LB1|MUTS_SACD2 DNA mismatch repair protein MutS OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=mutS PE=3 SV=1 229 816 3.0E-41
sp|Q81WR3|MUTS_BACAN DNA mismatch repair protein MutS OS=Bacillus anthracis GN=mutS PE=3 SV=1 262 828 3.0E-41
sp|C3L822|MUTS_BACAC DNA mismatch repair protein MutS OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=mutS PE=3 SV=1 262 828 3.0E-41
sp|C3P5H5|MUTS_BACAA DNA mismatch repair protein MutS OS=Bacillus anthracis (strain A0248) GN=mutS PE=3 SV=1 262 828 3.0E-41
sp|Q7VKA1|MUTS_HAEDU DNA mismatch repair protein MutS OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=mutS PE=3 SV=1 94 835 3.0E-41
sp|B7JJ47|MUTS_BACC0 DNA mismatch repair protein MutS OS=Bacillus cereus (strain AH820) GN=mutS PE=3 SV=1 262 828 3.0E-41
sp|B7HLA3|MUTS_BACC7 DNA mismatch repair protein MutS OS=Bacillus cereus (strain AH187) GN=mutS PE=3 SV=1 262 828 3.0E-41
sp|A8F164|MUTS_RICM5 DNA mismatch repair protein MutS OS=Rickettsia massiliae (strain Mtu5) GN=mutS PE=3 SV=1 228 826 4.0E-41
sp|P54275|MSH2_RAT DNA mismatch repair protein Msh2 OS=Rattus norvegicus GN=Msh2 PE=2 SV=1 499 879 4.0E-41
sp|Q553L4|MSH2_DICDI DNA mismatch repair protein Msh2 OS=Dictyostelium discoideum GN=msh2 PE=3 SV=1 287 848 4.0E-41
sp|Q6HF46|MUTS_BACHK DNA mismatch repair protein MutS OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=mutS PE=3 SV=1 262 828 4.0E-41
sp|B1HRG8|MUTS_LYSSC DNA mismatch repair protein MutS OS=Lysinibacillus sphaericus (strain C3-41) GN=mutS PE=3 SV=1 235 816 4.0E-41
sp|C1ENZ3|MUTS_BACC3 DNA mismatch repair protein MutS OS=Bacillus cereus (strain 03BB102) GN=mutS PE=3 SV=1 262 828 4.0E-41
sp|A0RHE1|MUTS_BACAH DNA mismatch repair protein MutS OS=Bacillus thuringiensis (strain Al Hakam) GN=mutS PE=3 SV=1 262 828 5.0E-41
sp|Q5UZG9|MUTS1_HALMA DNA mismatch repair protein MutS 1 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=mutS1 PE=3 SV=2 509 824 5.0E-41
sp|A3D786|MUTS_SHEB5 DNA mismatch repair protein MutS OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=mutS PE=3 SV=1 260 823 6.0E-41
sp|A3LU10|MSH3_PICST DNA mismatch repair protein MSH3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=MSH3 PE=3 SV=3 151 828 7.0E-41
sp|B2VG22|MUTS_ERWT9 DNA mismatch repair protein MutS OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=mutS PE=3 SV=1 248 823 7.0E-41
sp|Q60BA1|MUTS_METCA DNA mismatch repair protein MutS OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=mutS PE=3 SV=1 227 834 8.0E-41
sp|Q1WT15|MUTS_LACS1 DNA mismatch repair protein MutS OS=Lactobacillus salivarius (strain UCC118) GN=mutS PE=3 SV=1 532 836 8.0E-41
sp|Q6G542|MUTS_BARHE DNA mismatch repair protein MutS OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=mutS PE=3 SV=1 228 840 8.0E-41
sp|A5DEV6|MSH3_PICGU DNA mismatch repair protein MSH3 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=MSH3 PE=3 SV=2 267 834 9.0E-41
sp|Q0BV38|MUTS_GRABC DNA mismatch repair protein MutS OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=mutS PE=3 SV=1 262 823 1.0E-40
sp|Q9ZDM9|MUTS_RICPR DNA mismatch repair protein MutS OS=Rickettsia prowazekii (strain Madrid E) GN=mutS PE=3 SV=1 228 839 1.0E-40
sp|A7MJ43|MUTS_CROS8 DNA mismatch repair protein MutS OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=mutS PE=3 SV=1 227 823 1.0E-40
sp|A2C5A9|MUTS_PROM1 DNA mismatch repair protein MutS OS=Prochlorococcus marinus (strain NATL1A) GN=mutS PE=3 SV=1 548 832 1.0E-40
sp|Q03VV4|MUTS_LEUMM DNA mismatch repair protein MutS OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=mutS PE=3 SV=1 545 823 1.0E-40
sp|C1DSR1|MUTS_AZOVD DNA mismatch repair protein MutS OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=mutS PE=3 SV=1 248 818 1.0E-40
sp|A6GWN3|MUTS_FLAPJ DNA mismatch repair protein MutS OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=mutS PE=3 SV=1 122 827 1.0E-40
sp|Q1RJJ5|MUTS_RICBR DNA mismatch repair protein MutS OS=Rickettsia bellii (strain RML369-C) GN=mutS PE=3 SV=1 228 819 2.0E-40
sp|Q3A4F1|MUTS_PELCD DNA mismatch repair protein MutS OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=mutS PE=3 SV=1 232 823 2.0E-40
sp|A4J5Q6|MUTS_DESRM DNA mismatch repair protein MutS OS=Desulfotomaculum reducens (strain MI-1) GN=mutS PE=3 SV=1 556 823 2.0E-40
sp|A5N8I5|MUTS_CLOK5 DNA mismatch repair protein MutS OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=mutS PE=3 SV=1 553 839 2.0E-40
sp|B9E1Z0|MUTS_CLOK1 DNA mismatch repair protein MutS OS=Clostridium kluyveri (strain NBRC 12016) GN=mutS PE=3 SV=1 553 839 2.0E-40
sp|A1DCB2|MSH3_NEOFI DNA mismatch repair protein msh3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=msh3 PE=3 SV=1 258 818 2.0E-40
sp|A8GX86|MUTS_RICB8 DNA mismatch repair protein MutS OS=Rickettsia bellii (strain OSU 85-389) GN=mutS PE=3 SV=1 228 839 2.0E-40
sp|Q8G310|MUTS_BRUSU DNA mismatch repair protein MutS OS=Brucella suis biovar 1 (strain 1330) GN=mutS PE=3 SV=1 105 840 2.0E-40
sp|A9M792|MUTS_BRUC2 DNA mismatch repair protein MutS OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=mutS PE=3 SV=1 105 840 2.0E-40
sp|Q68X73|MUTS_RICTY DNA mismatch repair protein MutS OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=mutS PE=3 SV=1 228 819 2.0E-40
sp|A1WXK9|MUTS_HALHL DNA mismatch repair protein MutS OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=mutS PE=3 SV=1 107 823 3.0E-40
sp|Q4UM86|MUTS_RICFE DNA mismatch repair protein MutS OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=mutS PE=3 SV=1 228 839 3.0E-40
sp|A5UE20|MUTS_HAEIE DNA mismatch repair protein MutS OS=Haemophilus influenzae (strain PittEE) GN=mutS PE=3 SV=1 167 830 3.0E-40
sp|Q4QML2|MUTS_HAEI8 DNA mismatch repair protein MutS OS=Haemophilus influenzae (strain 86-028NP) GN=mutS PE=3 SV=1 167 826 3.0E-40
sp|A6KZM1|MUTS_BACV8 DNA mismatch repair protein MutS OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=mutS PE=3 SV=1 264 832 4.0E-40
sp|Q92IL9|MUTS_RICCN DNA mismatch repair protein MutS OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=mutS PE=3 SV=1 228 839 4.0E-40
sp|Q8KCC0|MUTS_CHLTE DNA mismatch repair protein MutS OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=mutS PE=3 SV=1 552 825 5.0E-40
sp|Q2GG13|MUTS_EHRCR DNA mismatch repair protein MutS OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=mutS PE=3 SV=1 260 828 5.0E-40
sp|Q6LMU0|MUTS_PHOPR DNA mismatch repair protein MutS OS=Photobacterium profundum GN=mutS PE=3 SV=1 248 826 5.0E-40
sp|C3PN02|MUTS_RICAE DNA mismatch repair protein MutS OS=Rickettsia africae (strain ESF-5) GN=mutS PE=3 SV=1 228 839 6.0E-40
sp|Q8YES6|MUTS_BRUME DNA mismatch repair protein MutS OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=mutS PE=3 SV=2 105 840 6.0E-40
sp|A7MTT8|MUTS_VIBCB DNA mismatch repair protein MutS OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=mutS PE=3 SV=1 227 838 7.0E-40
sp|A8GRI6|MUTS_RICRS DNA mismatch repair protein MutS OS=Rickettsia rickettsii (strain Sheila Smith) GN=mutS PE=3 SV=1 228 839 7.0E-40
sp|B0BWY8|MUTS_RICRO DNA mismatch repair protein MutS OS=Rickettsia rickettsii (strain Iowa) GN=mutS PE=3 SV=1 228 839 7.0E-40
sp|B0CIQ5|MUTS_BRUSI DNA mismatch repair protein MutS OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=mutS PE=3 SV=1 105 840 1.0E-39
sp|Q2N5V9|MUTS_ERYLH DNA mismatch repair protein MutS OS=Erythrobacter litoralis (strain HTCC2594) GN=mutS PE=3 SV=1 226 830 1.0E-39
sp|A0LG76|MUTS_SYNFM DNA mismatch repair protein MutS OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=mutS PE=3 SV=1 260 823 1.0E-39
sp|Q46IE5|MUTS_PROMT DNA mismatch repair protein MutS OS=Prochlorococcus marinus (strain NATL2A) GN=mutS PE=3 SV=1 534 832 1.0E-39
sp|P70755|MUTS_AQUPY DNA mismatch repair protein MutS OS=Aquifex pyrophilus GN=mutS PE=3 SV=1 527 823 1.0E-39
sp|B1N025|MUTS_LEUCK DNA mismatch repair protein MutS OS=Leuconostoc citreum (strain KM20) GN=mutS PE=3 SV=1 549 823 1.0E-39
sp|Q0BDU3|MUTS_BURCM DNA mismatch repair protein MutS OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=mutS PE=3 SV=1 249 818 1.0E-39
sp|B1YSP3|MUTS_BURA4 DNA mismatch repair protein MutS OS=Burkholderia ambifaria (strain MC40-6) GN=mutS PE=3 SV=1 249 818 2.0E-39
sp|P27345|MUTS_AZOVI DNA mismatch repair protein MutS OS=Azotobacter vinelandii GN=mutS PE=3 SV=1 248 818 2.0E-39
sp|Q3ANH5|MUTS_SYNSC DNA mismatch repair protein MutS OS=Synechococcus sp. (strain CC9605) GN=mutS PE=3 SV=1 260 823 2.0E-39
sp|A5FQC0|MUTS_DEHMB DNA mismatch repair protein MutS OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=mutS PE=3 SV=1 227 823 2.0E-39
sp|Q7V9M5|MUTS_PROMA DNA mismatch repair protein MutS OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=mutS PE=3 SV=1 260 823 2.0E-39
sp|Q5UYI1|MUTS2_HALMA DNA mismatch repair protein MutS 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=mutS2 PE=3 SV=2 209 837 2.0E-39
sp|Q0UXL8|MSH3_PHANO DNA mismatch repair protein MSH3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MSH3 PE=3 SV=3 529 837 2.0E-39
sp|A4WVX8|MUTS_RHOS5 DNA mismatch repair protein MutS OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=mutS PE=3 SV=1 261 830 2.0E-39
sp|B3CQY2|MUTS_ORITI DNA mismatch repair protein MutS OS=Orientia tsutsugamushi (strain Ikeda) GN=mutS PE=3 SV=1 259 836 3.0E-39
sp|Q1BHQ1|MUTS_BURCA DNA mismatch repair protein MutS OS=Burkholderia cenocepacia (strain AU 1054) GN=mutS PE=3 SV=1 94 818 3.0E-39
sp|Q1GCK9|MUTS_RUEST DNA mismatch repair protein MutS OS=Ruegeria sp. (strain TM1040) GN=mutS PE=3 SV=1 256 830 3.0E-39
sp|A5CDU2|MUTS_ORITB DNA mismatch repair protein MutS OS=Orientia tsutsugamushi (strain Boryong) GN=mutS PE=3 SV=1 504 836 3.0E-39
sp|A6V1G8|MUTS_PSEA7 DNA mismatch repair protein MutS OS=Pseudomonas aeruginosa (strain PA7) GN=mutS PE=3 SV=1 248 826 3.0E-39
sp|O65607|MSH3_ARATH DNA mismatch repair protein MSH3 OS=Arabidopsis thaliana GN=MSH3 PE=1 SV=2 551 835 3.0E-39
sp|Q5LWH0|MUTS_RUEPO DNA mismatch repair protein MutS OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=mutS PE=3 SV=1 256 834 3.0E-39
sp|Q57FM9|MUTS_BRUAB DNA mismatch repair protein MutS OS=Brucella abortus biovar 1 (strain 9-941) GN=mutS PE=3 SV=1 105 840 4.0E-39
sp|Q2YNZ0|MUTS_BRUA2 DNA mismatch repair protein MutS OS=Brucella abortus (strain 2308) GN=mutS PE=3 SV=1 105 840 4.0E-39
sp|Q6D8C1|MUTS_PECAS DNA mismatch repair protein MutS OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=mutS PE=3 SV=1 248 823 4.0E-39
sp|Q31KZ2|MUTS_SYNE7 DNA mismatch repair protein MutS OS=Synechococcus elongatus (strain PCC 7942) GN=mutS PE=3 SV=1 123 838 4.0E-39
sp|Q1C471|MUTS_YERPA DNA mismatch repair protein MutS OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=mutS PE=3 SV=1 248 823 4.0E-39
sp|Q3KH79|MUTS_PSEPF DNA mismatch repair protein MutS OS=Pseudomonas fluorescens (strain Pf0-1) GN=mutS PE=3 SV=1 248 818 4.0E-39
sp|A4TQ04|MUTS_YERPP DNA mismatch repair protein MutS OS=Yersinia pestis (strain Pestoides F) GN=mutS PE=3 SV=1 248 823 4.0E-39
sp|Q1CLQ9|MUTS_YERPN DNA mismatch repair protein MutS OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=mutS PE=3 SV=1 248 823 4.0E-39
sp|A9R111|MUTS_YERPG DNA mismatch repair protein MutS OS=Yersinia pestis bv. Antiqua (strain Angola) GN=mutS PE=3 SV=1 248 823 4.0E-39
sp|Q8ZBQ3|MUTS_YERPE DNA mismatch repair protein MutS OS=Yersinia pestis GN=mutS PE=3 SV=1 248 823 4.0E-39
sp|A4JFW7|MUTS_BURVG DNA mismatch repair protein MutS OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=mutS PE=3 SV=1 249 818 5.0E-39
sp|A8I275|MUTS_AZOC5 DNA mismatch repair protein MutS OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=mutS PE=3 SV=1 261 840 5.0E-39
sp|Q7V978|MUTS_PROMM DNA mismatch repair protein MutS OS=Prochlorococcus marinus (strain MIT 9313) GN=mutS PE=3 SV=1 260 824 5.0E-39
sp|B7V8C8|MUTS_PSEA8 DNA mismatch repair protein MutS OS=Pseudomonas aeruginosa (strain LESB58) GN=mutS PE=3 SV=1 248 826 5.0E-39
sp|B4T436|MUTS_SALNS DNA mismatch repair protein MutS OS=Salmonella newport (strain SL254) GN=mutS PE=3 SV=1 227 823 6.0E-39
sp|Q02R92|MUTS_PSEAB DNA mismatch repair protein MutS OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=mutS PE=3 SV=1 248 826 6.0E-39
sp|Q5N0X9|MUTS_SYNP6 DNA mismatch repair protein MutS OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=mutS PE=3 SV=1 123 838 6.0E-39
sp|C4K6P7|MUTS_HAMD5 DNA mismatch repair protein MutS OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=mutS PE=3 SV=1 248 818 6.0E-39
sp|Q9HY08|MUTS_PSEAE DNA mismatch repair protein MutS OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=mutS PE=3 SV=1 248 826 6.0E-39
sp|A8ANU8|MUTS_CITK8 DNA mismatch repair protein MutS OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mutS PE=3 SV=1 227 823 6.0E-39
sp|Q89AD3|MUTS_BUCBP DNA mismatch repair protein MutS OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mutS PE=3 SV=1 227 821 6.0E-39
sp|B1JJF1|MUTS_YERPY DNA mismatch repair protein MutS OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=mutS PE=3 SV=1 248 823 6.0E-39
sp|C6DAK6|MUTS_PECCP DNA mismatch repair protein MutS OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=mutS PE=3 SV=1 248 823 6.0E-39
sp|C0PWV2|MUTS_SALPC DNA mismatch repair protein MutS OS=Salmonella paratyphi C (strain RKS4594) GN=mutS PE=3 SV=1 227 823 7.0E-39
sp|A8LPD4|MUTS_DINSH DNA mismatch repair protein MutS OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=mutS PE=3 SV=1 171 823 7.0E-39
sp|Q66EB5|MUTS_YERPS DNA mismatch repair protein MutS OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=mutS PE=3 SV=1 248 823 8.0E-39
sp|B2K584|MUTS_YERPB DNA mismatch repair protein MutS OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=mutS PE=3 SV=1 248 823 8.0E-39
sp|A7FLX1|MUTS_YERP3 DNA mismatch repair protein MutS OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=mutS PE=3 SV=1 248 823 8.0E-39
sp|Q3B0S2|MUTS_SYNS9 DNA mismatch repair protein MutS OS=Synechococcus sp. (strain CC9902) GN=mutS PE=3 SV=1 552 823 8.0E-39
sp|Q03R33|MUTS_LACBA DNA mismatch repair protein MutS OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=mutS PE=3 SV=1 534 823 8.0E-39
sp|Q65QA9|MUTS_MANSM DNA mismatch repair protein MutS OS=Mannheimia succiniciproducens (strain MBEL55E) GN=mutS PE=3 SV=1 169 849 8.0E-39
sp|A1S4E6|MUTS_SHEAM DNA mismatch repair protein MutS OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=mutS PE=3 SV=1 260 818 9.0E-39
sp|P0A1Y0|MUTS_SALTY DNA mismatch repair protein MutS OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mutS PE=1 SV=1 227 823 1.0E-38
sp|P0A1Y1|MUTS_SALTI DNA mismatch repair protein MutS OS=Salmonella typhi GN=mutS PE=3 SV=1 227 823 1.0E-38
sp|A9N1F8|MUTS_SALPB DNA mismatch repair protein MutS OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mutS PE=3 SV=2 227 823 1.0E-38
sp|B4TFU6|MUTS_SALHS DNA mismatch repair protein MutS OS=Salmonella heidelberg (strain SL476) GN=mutS PE=3 SV=1 227 823 1.0E-38
sp|B5RDN2|MUTS_SALG2 DNA mismatch repair protein MutS OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=mutS PE=3 SV=1 227 823 1.0E-38
sp|Q57KL5|MUTS_SALCH DNA mismatch repair protein MutS OS=Salmonella choleraesuis (strain SC-B67) GN=mutS PE=3 SV=1 227 823 1.0E-38
sp|B5F3Y8|MUTS_SALA4 DNA mismatch repair protein MutS OS=Salmonella agona (strain SL483) GN=mutS PE=3 SV=1 227 823 1.0E-38
sp|B3QPY5|MUTS_CHLP8 DNA mismatch repair protein MutS OS=Chlorobaculum parvum (strain NCIB 8327) GN=mutS PE=3 SV=1 548 825 1.0E-38
sp|A2C5T5|MUTS_PROM3 DNA mismatch repair protein MutS OS=Prochlorococcus marinus (strain MIT 9303) GN=mutS PE=3 SV=1 548 823 1.0E-38
sp|Q5PEE6|MUTS_SALPA DNA mismatch repair protein MutS OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mutS PE=3 SV=1 227 823 1.0E-38
sp|Q82U08|MUTS_NITEU DNA mismatch repair protein MutS OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=mutS PE=3 SV=1 466 839 1.0E-38
sp|A8FDH3|MUTS_BACP2 DNA mismatch repair protein MutS OS=Bacillus pumilus (strain SAFR-032) GN=mutS PE=3 SV=1 544 823 1.0E-38
sp|A7HZ64|MUTS_PARL1 DNA mismatch repair protein MutS OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=mutS PE=3 SV=1 260 823 1.0E-38
sp|B7ITM1|MUTS_BACC2 DNA mismatch repair protein MutS OS=Bacillus cereus (strain G9842) GN=mutS PE=3 SV=1 535 828 1.0E-38
sp|B7HDP4|MUTS_BACC4 DNA mismatch repair protein MutS OS=Bacillus cereus (strain B4264) GN=mutS PE=3 SV=1 535 828 1.0E-38
sp|C5BGI4|MUTS_EDWI9 DNA mismatch repair protein MutS OS=Edwardsiella ictaluri (strain 93-146) GN=mutS PE=3 SV=1 245 833 1.0E-38
sp|Q051T9|MUTS_LEPBL DNA mismatch repair protein MutS OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=mutS PE=3 SV=1 231 831 2.0E-38
sp|Q04RT2|MUTS_LEPBJ DNA mismatch repair protein MutS OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=mutS PE=3 SV=1 231 831 2.0E-38
sp|P43248|MSH2_DROME DNA mismatch repair protein spellchecker 1 OS=Drosophila melanogaster GN=spel1 PE=3 SV=4 289 885 2.0E-38
sp|A9MF43|MUTS_SALAR DNA mismatch repair protein MutS OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=mutS PE=3 SV=1 227 823 2.0E-38
sp|P44834|MUTS_HAEIN DNA mismatch repair protein MutS OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=mutS PE=3 SV=1 167 826 2.0E-38
sp|Q2NVL9|MUTS_SODGM DNA mismatch repair protein MutS OS=Sodalis glossinidius (strain morsitans) GN=mutS PE=3 SV=1 248 823 2.0E-38
sp|A1UU95|MUTS_BARBK DNA mismatch repair protein MutS OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=mutS PE=3 SV=1 467 840 2.0E-38
sp|Q5QUB6|MUTS_IDILO DNA mismatch repair protein MutS OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=mutS PE=3 SV=2 248 826 2.0E-38
sp|Q48F92|MUTS_PSE14 DNA mismatch repair protein MutS OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=mutS PE=3 SV=1 248 826 2.0E-38
sp|A5GHU5|MUTS_SYNPW DNA mismatch repair protein MutS OS=Synechococcus sp. (strain WH7803) GN=mutS PE=3 SV=1 552 823 2.0E-38
sp|B9LB04|MUTS_CHLSY DNA mismatch repair protein MutS OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=mutS PE=3 SV=1 21 827 2.0E-38
sp|A9WFZ9|MUTS_CHLAA DNA mismatch repair protein MutS OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=mutS PE=3 SV=1 21 827 2.0E-38
sp|P61669|MUTS_LEPIC DNA mismatch repair protein MutS OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=mutS PE=3 SV=1 230 829 2.0E-38
sp|Q5WFY3|MUTS_BACSK DNA mismatch repair protein MutS OS=Bacillus clausii (strain KSM-K16) GN=mutS PE=3 SV=1 546 823 2.0E-38
sp|A6TD24|MUTS_KLEP7 DNA mismatch repair protein MutS OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mutS PE=3 SV=1 227 823 3.0E-38
sp|B4TTU0|MUTS_SALSV DNA mismatch repair protein MutS OS=Salmonella schwarzengrund (strain CVM19633) GN=mutS PE=3 SV=1 227 823 3.0E-38
sp|A1B095|MUTS_PARDP DNA mismatch repair protein MutS OS=Paracoccus denitrificans (strain Pd 1222) GN=mutS PE=3 SV=1 467 823 3.0E-38
sp|Q8F496|MUTS_LEPIN DNA mismatch repair protein MutS OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=mutS PE=3 SV=1 230 829 3.0E-38
sp|Q3SVD4|MUTS_NITWN DNA mismatch repair protein MutS OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=mutS PE=3 SV=1 256 823 3.0E-38
sp|B5YJY3|MUTS_THEYD DNA mismatch repair protein MutS OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=mutS PE=3 SV=1 497 825 3.0E-38
sp|A4SIL2|MUTS_AERS4 DNA mismatch repair protein MutS OS=Aeromonas salmonicida (strain A449) GN=mutS PE=3 SV=1 227 816 4.0E-38
sp|Q2SBR5|MUTS_HAHCH DNA mismatch repair protein MutS OS=Hahella chejuensis (strain KCTC 2396) GN=mutS PE=3 SV=2 248 823 4.0E-38
sp|A1JJU1|MUTS_YERE8 DNA mismatch repair protein MutS OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=mutS PE=3 SV=1 248 823 4.0E-38
sp|Q47DJ8|MUTS_DECAR DNA mismatch repair protein MutS OS=Dechloromonas aromatica (strain RCB) GN=mutS PE=3 SV=1 121 818 4.0E-38
sp|Q4ZWP5|MUTS_PSEU2 DNA mismatch repair protein MutS OS=Pseudomonas syringae pv. syringae (strain B728a) GN=mutS PE=3 SV=1 248 826 4.0E-38
sp|B5XV49|MUTS_KLEP3 DNA mismatch repair protein MutS OS=Klebsiella pneumoniae (strain 342) GN=mutS PE=3 SV=1 227 823 5.0E-38
sp|Q7NLT8|MUTS_GLOVI DNA mismatch repair protein MutS OS=Gloeobacter violaceus (strain PCC 7421) GN=mutS PE=3 SV=1 102 819 5.0E-38
sp|Q7WLT5|MUTS_BORBR DNA mismatch repair protein MutS OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=mutS PE=3 SV=2 109 816 6.0E-38
sp|A4WDU5|MUTS_ENT38 DNA mismatch repair protein MutS OS=Enterobacter sp. (strain 638) GN=mutS PE=3 SV=1 227 823 6.0E-38
sp|Q11B27|MUTS_CHESB DNA mismatch repair protein MutS OS=Chelativorans sp. (strain BNC1) GN=mutS PE=3 SV=1 459 840 7.0E-38
sp|A3N2Q0|MUTS_ACTP2 DNA mismatch repair protein MutS OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=mutS PE=3 SV=1 556 836 8.0E-38
sp|P0CO92|MSH3_CRYNJ DNA mismatch repair protein MSH3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MSH3 PE=3 SV=1 545 843 9.0E-38
sp|Q8Y093|MUTS_RALSO DNA mismatch repair protein MutS OS=Ralstonia solanacearum (strain GMI1000) GN=mutS PE=3 SV=1 109 818 9.0E-38
sp|P0CO93|MSH3_CRYNB DNA mismatch repair protein MSH3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MSH3 PE=3 SV=1 545 843 9.0E-38
sp|Q7NRW7|MUTS_CHRVO DNA mismatch repair protein MutS OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=mutS PE=3 SV=1 466 816 9.0E-38
sp|A8G9Z9|MUTS_SERP5 DNA mismatch repair protein MutS OS=Serratia proteamaculans (strain 568) GN=mutS PE=3 SV=1 248 823 1.0E-37
sp|Q7W880|MUTS_BORPA DNA mismatch repair protein MutS OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=mutS PE=3 SV=2 109 816 1.0E-37
sp|B0BRS8|MUTS_ACTPJ DNA mismatch repair protein MutS OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=mutS PE=3 SV=1 556 836 1.0E-37
sp|Q2WAN4|MUTS_MAGSA DNA mismatch repair protein MutS OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=mutS PE=3 SV=2 465 866 1.0E-37
sp|Q0VNJ1|MUTS_ALCBS DNA mismatch repair protein MutS OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=mutS PE=3 SV=1 546 827 1.0E-37
sp|Q7N8K0|MUTS_PHOLL DNA mismatch repair protein MutS OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=mutS PE=3 SV=1 550 823 1.0E-37
sp|P61673|MUTS_WOLPM DNA mismatch repair protein MutS OS=Wolbachia pipientis wMel GN=mutS PE=3 SV=1 517 824 2.0E-37
sp|C0R5H4|MUTS_WOLWR DNA mismatch repair protein MutS OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=mutS PE=3 SV=1 517 824 2.0E-37
sp|Q2KD76|MUTS_RHIEC DNA mismatch repair protein MutS OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=mutS PE=3 SV=1 261 837 2.0E-37
sp|Q81A25|MUTS_BACCR DNA mismatch repair protein MutS OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=mutS PE=3 SV=1 535 828 2.0E-37
sp|Q0AEI7|MUTS_NITEC DNA mismatch repair protein MutS OS=Nitrosomonas eutropha (strain C91) GN=mutS PE=3 SV=1 466 825 2.0E-37
sp|Q87XW6|MUTS_PSESM DNA mismatch repair protein MutS OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=mutS PE=3 SV=1 248 826 2.0E-37
sp|P61670|MUTS_RHOPA DNA mismatch repair protein MutS OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=mutS PE=3 SV=1 106 823 2.0E-37
sp|Q9AC54|MUTS_CAUCR DNA mismatch repair protein MutS OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=mutS PE=3 SV=1 254 837 2.0E-37
sp|B0TK13|MUTS_SHEHH DNA mismatch repair protein MutS OS=Shewanella halifaxensis (strain HAW-EB4) GN=mutS PE=3 SV=1 253 838 2.0E-37
sp|Q38YR4|MUTS_LACSS DNA mismatch repair protein MutS OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=mutS PE=3 SV=1 527 823 2.0E-37
sp|Q5B6T1|MSH3_EMENI DNA mismatch repair protein msh3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=msh3 PE=3 SV=2 545 883 2.0E-37
sp|B4F220|MUTS_PROMH DNA mismatch repair protein MutS OS=Proteus mirabilis (strain HI4320) GN=mutS PE=3 SV=1 550 823 2.0E-37
sp|Q3Z767|MUTS_DEHM1 DNA mismatch repair protein MutS OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=mutS PE=3 SV=1 557 823 3.0E-37
sp|Q63SR9|MUTS_BURPS DNA mismatch repair protein MutS OS=Burkholderia pseudomallei (strain K96243) GN=mutS PE=3 SV=1 109 818 4.0E-37
sp|P57972|MUTS_PASMU DNA mismatch repair protein MutS OS=Pasteurella multocida (strain Pm70) GN=mutS PE=3 SV=1 552 837 4.0E-37
sp|A3NWZ4|MUTS_BURP0 DNA mismatch repair protein MutS OS=Burkholderia pseudomallei (strain 1106a) GN=mutS PE=3 SV=2 109 818 5.0E-37
sp|Q3SJP0|MUTS_THIDA DNA mismatch repair protein MutS OS=Thiobacillus denitrificans (strain ATCC 25259) GN=mutS PE=3 SV=1 465 828 5.0E-37
sp|Q7UA23|MUTS_SYNPX DNA mismatch repair protein MutS OS=Synechococcus sp. (strain WH8102) GN=mutS PE=3 SV=1 556 819 5.0E-37
sp|A1K764|MUTS_AZOSB DNA mismatch repair protein MutS OS=Azoarcus sp. (strain BH72) GN=mutS PE=3 SV=2 249 823 5.0E-37
sp|A1V5I2|MUTS_BURMS DNA mismatch repair protein MutS OS=Burkholderia mallei (strain SAVP1) GN=mutS PE=3 SV=2 109 818 5.0E-37
sp|Q62J26|MUTS_BURMA DNA mismatch repair protein MutS OS=Burkholderia mallei (strain ATCC 23344) GN=mutS PE=3 SV=1 109 818 5.0E-37
sp|A2SAW7|MUTS_BURM9 DNA mismatch repair protein MutS OS=Burkholderia mallei (strain NCTC 10229) GN=mutS PE=3 SV=2 109 818 5.0E-37
sp|A3ML57|MUTS_BURM7 DNA mismatch repair protein MutS OS=Burkholderia mallei (strain NCTC 10247) GN=mutS PE=3 SV=2 109 818 5.0E-37
sp|B5EA63|MUTS_GEOBB DNA mismatch repair protein MutS OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=mutS PE=3 SV=1 247 825 5.0E-37
sp|B3QPY5|MUTS_CHLP8 DNA mismatch repair protein MutS OS=Chlorobaculum parvum (strain NCIB 8327) GN=mutS PE=3 SV=1 105 337 2.0E-09
sp|A5N8I5|MUTS_CLOK5 DNA mismatch repair protein MutS OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=mutS PE=3 SV=1 232 331 2.0E-08
sp|B9E1Z0|MUTS_CLOK1 DNA mismatch repair protein MutS OS=Clostridium kluyveri (strain NBRC 12016) GN=mutS PE=3 SV=1 232 331 2.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0030983 mismatched DNA binding Yes
GO:0006298 mismatch repair Yes
GO:0005524 ATP binding Yes
GO:0090304 nucleic acid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0044260 cellular macromolecule metabolic process No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0043167 ion binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0003677 DNA binding No
GO:0046483 heterocycle metabolic process No
GO:0003676 nucleic acid binding No
GO:0005488 binding No
GO:0044238 primary metabolic process No
GO:0006259 DNA metabolic process No
GO:0050896 response to stimulus No
GO:0043168 anion binding No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:1901360 organic cyclic compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0033554 cellular response to stress No
GO:0006950 response to stress No
GO:1901265 nucleoside phosphate binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0006281 DNA repair No
GO:0006807 nitrogen compound metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0003690 double-stranded DNA binding No
GO:0051716 cellular response to stimulus No
GO:0097367 carbohydrate derivative binding No
GO:0000166 nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0017076 purine nucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0009987 cellular process No
GO:0043170 macromolecule metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4528
MSRHGYIEESPPPSSSAYFGHSSQFLSSASSQALSSTGSTLTTRPEERRPRAPQYTPSVTSTGRSRGRSTSRTST
SRTGTRPSTASGRNKSRAGTASSILGLGEQQNIICALGESRGVTPSVGVAFVNASLGEVILSQICDNQSYVKTIH
KIQMLTPSRIIFMSSACPPQKSSTLFSLVQELVPEARCDAFDRSAWSEHSGIDYINRLACPPDVEPVKVALHGKY
YSICSFAAAMKYLDHQFSISFAPHSLRVRYQPSEDTMMIDISAIQSLEIMQNLHNPKSKDCLYGLLNHTSTPMGA
RMLRSNILQPPTPRDSFITPRYDALEELTTNEEMFRELIIVPSDATVVQMEEEIGQILMIKSFVESAPKLFKALG
PAKSALLVKIRDLCHPEVTGPVLAGIRNVIEADVTYLKSPLDLRNQRTFAVKTGISGMLDVARQTYKELTEEVHQ
HVDRLSGSEEFRIRATLKFDNGRKYWLRLKASAFQGGTLPPVFINQVRKRDVVECQTLDLVKLNVRLSDTSNEVV
IRSDAVVRDLMQDLRQASPQLFRVCESVALIDMIASFAQLATTRGYIRPEITDTLALKSARHPIMDKVSGAQLCI
QDVVVLTRWRQTLDGSFVPNDYYATEQYSFHVVTGCNMSGKSTYIRAVALLQIMAQIGSFVPAEYASFPVIRNIF
ARVSLDDSIEASLSTFSIEMREMAFLLRNVDKESLAIIDELGRGTSTRDGLAIAMAMSEALVETRASVWFATHFV
DLARVLGQRAGVLKLHLAAETSKTADGLPQITMLYKATAGTVDEQEHYGIHLARAVGFPSSFIEKAEQVAKSLRR
TREESRQSSESRRLVARRKLLLNLHGALVQARDSGSEEALPGYLRRLQEEFVHRMEELDSMSI
Coding >Ophio5|4528
ATGTCTCGCCACGGCTACATTGAGGAGTCGCCTCCGCCCTCCTCGTCCGCCTACTTCGGCCACAGCTCCCAATTC
CTGTCGTCGGCTAGTTCTCAGGCTTTATCATCGACCGGCTCTACGCTCACTACGAGACCAGAAGAGCGGCGTCCC
CGGGCTCCCCAGTACACACCGTCGGTGACCAGCACTGGACGCAGCAGGGGACGTAGCACCTCCCGTACCTCAACC
TCGCGCACCGGCACTCGACCCAGCACCGCTTCGGGCCGTAACAAGTCTCGCGCCGGAACAGCCTCGTCCATCTTG
GGTCTTGGCGAGCAGCAGAACATCATCTGCGCCCTGGGAGAGTCTCGCGGTGTCACGCCGTCGGTGGGCGTCGCC
TTCGTCAATGCCTCGCTGGGCGAGGTGATTCTCAGCCAGATCTGCGATAACCAGTCCTACGTCAAGACCATTCAC
AAGATCCAGATGCTGACGCCTTCTCGCATCATCTTCATGTCGTCAGCCTGTCCACCGCAAAAGTCAAGCACTCTC
TTCAGTCTCGTTCAGGAACTCGTCCCAGAAGCCCGCTGCGATGCTTTCGACCGCTCAGCTTGGTCAGAACACTCC
GGTATCGATTATATAAACAGGCTGGCCTGCCCTCCTGACGTCGAGCCTGTCAAGGTTGCGTTGCATGGAAAATAC
TACTCGATATGCTCATTTGCAGCTGCCATGAAATATCTTGATCACCAGTTCTCAATAAGCTTCGCTCCTCACTCA
CTCCGAGTCCGCTATCAACCGTCCGAGGACACAATGATGATCGACATTTCTGCCATTCAGTCCCTCGAGATCATG
CAGAACCTGCATAACCCCAAATCCAAGGACTGCTTATACGGCCTGCTCAACCATACATCGACACCAATGGGAGCT
CGCATGCTGCGCAGCAACATTCTCCAGCCACCAACCCCTCGTGATTCCTTCATAACGCCACGGTATGACGCTCTA
GAGGAGCTGACCACCAATGAAGAAATGTTCCGCGAGCTTATCATCGTCCCCTCTGACGCCACCGTGGTGCAGATG
GAGGAAGAGATCGGGCAGATTCTCATGATCAAAAGCTTTGTCGAGTCGGCTCCAAAGCTGTTCAAGGCTCTGGGC
CCGGCGAAGAGTGCCCTGCTGGTCAAGATTCGAGACCTCTGTCACCCAGAGGTCACCGGACCAGTTCTCGCCGGG
ATACGGAACGTCATTGAGGCTGACGTGACATATCTGAAATCGCCTCTGGACCTGCGAAATCAGAGGACGTTTGCC
GTCAAGACGGGAATTAGCGGCATGCTGGACGTGGCCCGGCAGACGTACAAAGAACTCACCGAAGAAGTCCATCAG
CACGTTGATCGACTTAGTGGCTCAGAGGAATTCCGCATCCGAGCCACTCTCAAGTTCGATAATGGGCGGAAGTAC
TGGCTCCGTCTCAAAGCCAGTGCATTTCAAGGCGGGACGCTTCCTCCAGTCTTCATCAACCAGGTGCGTAAAAGG
GACGTTGTTGAGTGCCAGACTCTGGATCTCGTCAAGCTCAACGTTCGGCTCTCCGACACGTCCAATGAAGTTGTC
ATCAGGAGCGACGCTGTGGTAAGAGACTTGATGCAGGATCTTCGGCAGGCATCGCCACAGCTGTTCCGAGTATGC
GAATCGGTCGCGCTCATCGATATGATCGCGTCCTTTGCCCAGCTGGCGACGACACGGGGCTACATTCGACCGGAG
ATAACAGACACTCTGGCGCTGAAGTCGGCACGGCATCCAATCATGGACAAGGTGAGCGGTGCCCAGCTTTGCATC
CAAGACGTGGTAGTATTGACGCGATGGCGGCAGACACTCGACGGCAGTTTCGTTCCGAACGACTACTACGCAACC
GAGCAATACAGCTTCCACGTCGTGACGGGCTGCAACATGAGCGGCAAGAGCACGTACATACGAGCTGTAGCGTTG
CTTCAGATCATGGCCCAGATAGGAAGCTTCGTACCGGCCGAGTACGCATCGTTCCCCGTCATTCGCAACATCTTC
GCGCGAGTTTCGCTGGATGACAGCATCGAGGCCAGCCTTTCGACCTTTTCCATCGAGATGCGCGAGATGGCTTTT
CTGCTGCGAAACGTGGACAAGGAGAGCCTGGCCATCATCGACGAGCTTGGCCGAGGGACGAGCACGCGAGACGGG
CTAGCCATTGCCATGGCCATGTCGGAAGCGTTGGTGGAGACGAGGGCGTCGGTGTGGTTCGCGACGCACTTTGTC
GACCTGGCACGTGTGCTAGGACAGCGCGCTGGCGTGCTGAAGCTCCATCTGGCGGCCGAGACGTCGAAGACGGCG
GATGGATTGCCGCAGATCACGATGCTCTACAAAGCCACGGCGGGCACGGTGGACGAGCAGGAGCACTACGGCATA
CATCTGGCGCGCGCCGTGGGGTTTCCGTCGAGCTTCATCGAGAAGGCAGAGCAAGTGGCAAAGTCGCTCCGTCGG
ACGAGAGAAGAGAGCCGACAGAGTTCCGAGTCGCGCAGACTGGTGGCAAGGCGGAAGCTGTTGCTGAACCTGCAC
GGGGCCCTCGTGCAGGCGCGGGACTCGGGAAGTGAGGAGGCCTTACCAGGCTATCTGCGACGGCTTCAAGAGGAG
TTTGTTCATCGGATGGAGGAGCTGGACAGCATGAGCATC
Transcript >Ophio5|4528
ATGTCTCGCCACGGCTACATTGAGGAGTCGCCTCCGCCCTCCTCGTCCGCCTACTTCGGCCACAGCTCCCAATTC
CTGTCGTCGGCTAGTTCTCAGGCTTTATCATCGACCGGCTCTACGCTCACTACGAGACCAGAAGAGCGGCGTCCC
CGGGCTCCCCAGTACACACCGTCGGTGACCAGCACTGGACGCAGCAGGGGACGTAGCACCTCCCGTACCTCAACC
TCGCGCACCGGCACTCGACCCAGCACCGCTTCGGGCCGTAACAAGTCTCGCGCCGGAACAGCCTCGTCCATCTTG
GGTCTTGGCGAGCAGCAGAACATCATCTGCGCCCTGGGAGAGTCTCGCGGTGTCACGCCGTCGGTGGGCGTCGCC
TTCGTCAATGCCTCGCTGGGCGAGGTGATTCTCAGCCAGATCTGCGATAACCAGTCCTACGTCAAGACCATTCAC
AAGATCCAGATGCTGACGCCTTCTCGCATCATCTTCATGTCGTCAGCCTGTCCACCGCAAAAGTCAAGCACTCTC
TTCAGTCTCGTTCAGGAACTCGTCCCAGAAGCCCGCTGCGATGCTTTCGACCGCTCAGCTTGGTCAGAACACTCC
GGTATCGATTATATAAACAGGCTGGCCTGCCCTCCTGACGTCGAGCCTGTCAAGGTTGCGTTGCATGGAAAATAC
TACTCGATATGCTCATTTGCAGCTGCCATGAAATATCTTGATCACCAGTTCTCAATAAGCTTCGCTCCTCACTCA
CTCCGAGTCCGCTATCAACCGTCCGAGGACACAATGATGATCGACATTTCTGCCATTCAGTCCCTCGAGATCATG
CAGAACCTGCATAACCCCAAATCCAAGGACTGCTTATACGGCCTGCTCAACCATACATCGACACCAATGGGAGCT
CGCATGCTGCGCAGCAACATTCTCCAGCCACCAACCCCTCGTGATTCCTTCATAACGCCACGGTATGACGCTCTA
GAGGAGCTGACCACCAATGAAGAAATGTTCCGCGAGCTTATCATCGTCCCCTCTGACGCCACCGTGGTGCAGATG
GAGGAAGAGATCGGGCAGATTCTCATGATCAAAAGCTTTGTCGAGTCGGCTCCAAAGCTGTTCAAGGCTCTGGGC
CCGGCGAAGAGTGCCCTGCTGGTCAAGATTCGAGACCTCTGTCACCCAGAGGTCACCGGACCAGTTCTCGCCGGG
ATACGGAACGTCATTGAGGCTGACGTGACATATCTGAAATCGCCTCTGGACCTGCGAAATCAGAGGACGTTTGCC
GTCAAGACGGGAATTAGCGGCATGCTGGACGTGGCCCGGCAGACGTACAAAGAACTCACCGAAGAAGTCCATCAG
CACGTTGATCGACTTAGTGGCTCAGAGGAATTCCGCATCCGAGCCACTCTCAAGTTCGATAATGGGCGGAAGTAC
TGGCTCCGTCTCAAAGCCAGTGCATTTCAAGGCGGGACGCTTCCTCCAGTCTTCATCAACCAGGTGCGTAAAAGG
GACGTTGTTGAGTGCCAGACTCTGGATCTCGTCAAGCTCAACGTTCGGCTCTCCGACACGTCCAATGAAGTTGTC
ATCAGGAGCGACGCTGTGGTAAGAGACTTGATGCAGGATCTTCGGCAGGCATCGCCACAGCTGTTCCGAGTATGC
GAATCGGTCGCGCTCATCGATATGATCGCGTCCTTTGCCCAGCTGGCGACGACACGGGGCTACATTCGACCGGAG
ATAACAGACACTCTGGCGCTGAAGTCGGCACGGCATCCAATCATGGACAAGGTGAGCGGTGCCCAGCTTTGCATC
CAAGACGTGGTAGTATTGACGCGATGGCGGCAGACACTCGACGGCAGTTTCGTTCCGAACGACTACTACGCAACC
GAGCAATACAGCTTCCACGTCGTGACGGGCTGCAACATGAGCGGCAAGAGCACGTACATACGAGCTGTAGCGTTG
CTTCAGATCATGGCCCAGATAGGAAGCTTCGTACCGGCCGAGTACGCATCGTTCCCCGTCATTCGCAACATCTTC
GCGCGAGTTTCGCTGGATGACAGCATCGAGGCCAGCCTTTCGACCTTTTCCATCGAGATGCGCGAGATGGCTTTT
CTGCTGCGAAACGTGGACAAGGAGAGCCTGGCCATCATCGACGAGCTTGGCCGAGGGACGAGCACGCGAGACGGG
CTAGCCATTGCCATGGCCATGTCGGAAGCGTTGGTGGAGACGAGGGCGTCGGTGTGGTTCGCGACGCACTTTGTC
GACCTGGCACGTGTGCTAGGACAGCGCGCTGGCGTGCTGAAGCTCCATCTGGCGGCCGAGACGTCGAAGACGGCG
GATGGATTGCCGCAGATCACGATGCTCTACAAAGCCACGGCGGGCACGGTGGACGAGCAGGAGCACTACGGCATA
CATCTGGCGCGCGCCGTGGGGTTTCCGTCGAGCTTCATCGAGAAGGCAGAGCAAGTGGCAAAGTCGCTCCGTCGG
ACGAGAGAAGAGAGCCGACAGAGTTCCGAGTCGCGCAGACTGGTGGCAAGGCGGAAGCTGTTGCTGAACCTGCAC
GGGGCCCTCGTGCAGGCGCGGGACTCGGGAAGTGAGGAGGCCTTACCAGGCTATCTGCGACGGCTTCAAGAGGAG
TTTGTTCATCGGATGGAGGAGCTGGACAGCATGAGCATCTAG
Gene >Ophio5|4528
ATGTCTCGCCACGGCTACATTGAGGAGTCGCCTCCGCCCTCCTCGTCCGCCTACTTCGGCCACAGCTCCCAATTC
CTGTCGTCGGCTAGTTCTCAGGCTTTATCATCGACCGGCTCTACGCTCACTACGAGACCAGAAGAGCGGCGTCCC
CGGGCTCCCCAGTACACACCGTCGGTGACCAGCACTGGACGCAGCAGGGGACGTAGCACCTCCCGTACCTCAACC
TCGCGCACCGGCACTCGACCCAGCACCGCTTCGGGCCGTAACAAGTCTCGCGCCGGAACAGCCTCGTCCATCTTG
GGTCTTGGCGAGCAGCAGAACATCATCTGCGCCCTGGGAGAGTCTCGCGGTGTCACGCCGTCGGTGGGCGTCGCC
TTCGTCAATGCCTCGCTGGGCGAGGTGATTCTCAGCCAGATCTGCGATAACCAGTCCTACGTCAAGACCATTCAC
AAGATCCAGATGCTGACGCCTTCTCGCATCATCTTCATGTCGTCAGCCTGTCCACCGCAAAAGTCAAGCACTCTC
TTCAGTCTCGTTCAGGAACTCGTCCCAGAAGCCCGCTGCGATGCTTTCGACCGCTCAGCTTGGTCAGAACACTCC
GGTATCGATTATATAAACAGGCTGGCCTGCCCTCCTGACGTCGAGCCTGTCAAGGTTGCGTTGCATGGAAAATAC
TACTCGATATGCTCATTTGCAGCTGTGAGTCGCTTCCCTGCTCTGTAGTCATGATCAAACTGACGCTGTTCATGT
ACGATTACCAGGCCATGAAATATCTTGATCACCAGTTCTCAATAAGCTTCGCTCCTCACTCACTCCGAGTCCGCT
ATCAACCGTCCGAGGACACAATGATGATCGACATTTCTGCCATTCAGTCCCTCGAGATCATGCAGAACCTGCATA
ACCCCAAATCCAAGGACTGCTTATACGGCCTGCTCAACCATACATCGACACCAATGGGAGCTCGCATGCTGCGCA
GCAACATTCTCCAGCCACCAACCCCTCGTGATTCCTTCATAACGCCACGGTATGACGCTCTAGAGGAGCTGACCA
CCAATGAAGAAATGTTCCGCGAGGTTCGCACCGGTTTGTGACCCTGCTCGGTATGTTTGTCACCGGTCTGACGCG
CAACCAGCCCTCAAGCTTTTCCACGACGTCGAAAGGTTACTCACCAAAGCAAGTTGGCTCCCATGCAACGCAAAT
GTTGACGTGGCTAACATGCTCAGCTTATCATCGTCCCCTCTGACGCCACCGTGGTGCAGATGGAGGAAGAGATCG
GGCAGATTCTCATGATCAAAAGCTTTGTCGAGTCGGCTCCAAAGCTGTTCAAGGCTCTGGGCCCGGCGAAGAGTG
CCCTGCTGGTCAAGATTCGAGACCTCTGTCACCCAGAGGTCACCGGACCAGTTCTCGCCGGGATACGGAACGTCA
TTGAGGCTGACGTGACATATCTGAAATCGCCTCTGGACCTGCGAAATCAGAGGACGTTTGCCGTCAAGACGGGAA
TTAGCGGCATGCTGGACGTGGCCCGGCAGACGTACAAAGAACTCACCGAAGAAGTCCATCAGCACGTTGATCGAC
TTAGTGGTTTGCGCTCTCTCCTGAGCTGGACCTGTCCCACAAACAGCTGACACAGGCTCAGAGGAATTCCGCATC
CGAGCCACTCTCAAGTTCGATAATGGGCGGAAGTACTGGCTCCGTCTCAAAGCCAGTGCATTTCAAGGCGGGACG
CTTCCTCCAGTCTTCATCAACCAGGTGCGTAAAAGGGACGTTGTTGAGTGCCAGACTCTGGATCTCGTCAAGCTC
AACGTTCGGCTCTCCGACACGTCCAATGAAGTTGTCATCAGGAGCGACGCTGTGGTAAGAGACTTGATGCAGGAT
CTTCGGCAGGCATCGCCACAGCTGTTCCGAGTATGCGAATCGGTCGCGCTCATCGATATGATCGCGTCCTTTGCC
CAGCTGGCGACGACACGGGGCTACATTCGACCGGAGATAACAGACACTCTGGCGCTGAAGTCGGCACGGCATCCA
ATCATGGACAAGGTGAGCGGTGCCCAGCTTTGCATCCAAGACGTGGTAGTATTGACGCGATGGCGGCAGACACTC
GACGGCAGTTTCGTTCCGAACGACTACTACGCAACCGAGCAATACAGCTTCCACGTCGTGACGGGCTGCAACATG
AGCGGCAAGAGCACGTACATACGAGCTGTAGCGTTGCTTCAGATCATGGCCCAGATAGGAAGCTTCGTACCGGCC
GAGTACGCATCGTTCCCCGTCATTCGCAACATCTTCGCGCGAGTTTCGCTGGATGACAGCATCGAGGCCAGCCTT
TCGACCTTTTCCATCGAGATGCGCGAGATGGCTTTTCTGCTGCGAAACGTGGACAAGGAGAGCCTGGCCATCATC
GACGAGCTTGGCCGAGGGACGAGCACGCGAGACGGGCTAGCCATTGCCATGGCCATGTCGGAAGCGTTGGTGGAG
ACGAGGGCGTCGGTGTGGTTCGCGACGCACTTTGTCGACCTGGCACGTGTGCTAGGACAGCGCGCTGGCGTGCTG
AAGCTCCATCTGGCGGCCGAGACGTCGAAGACGGCGGATGGATTGCCGCAGATCACGATGCTCTACAAAGCCACG
GCGGGCACGGTGGACGAGCAGGAGCACTACGGCATACATCTGGCGCGCGCCGTGGGGTTTCCGTCGAGCTTCATC
GAGAAGGCAGAGCAAGTGGCAAAGTCGCTCCGTCGGACGAGAGAAGAGAGCCGACAGAGTTCCGAGTCGCGCAGA
CTGGTGGCAAGGCGGAAGCTGTTGCTGAACCTGCACGGGGCCCTCGTGCAGGCGCGGGACTCGGGAAGTGAGGAG
GCCTTACCAGGCTATCTGCGACGGCTTCAAGAGGAGTTTGTTCATCGGATGGAGGAGCTGGACAGCATGAGCATC
TAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail