Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4523
Gene name
Locationscaffold_36:19895..21635
Strand+
Gene length (bp)1740
Transcript length (bp)1395
Coding sequence length (bp)1392
Protein length (aa) 464

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 104 126 22
2 139 161 22
3 181 203 22
4 224 246 22
5 266 288 22
6 300 322 22
7 337 356 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 69.04 37.37 100.70
CcL In ants, during behavior modification 45.29 23.84 66.74
CcD In ants, recently dead 47.54 25.59 69.48

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.068500 no
SC16a CcD 0.105512 no
CcL CcD 0.868921 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4523
MLVSTNGTPRRQLADAERPGSRGSDDRRRSLEAVLDGSQTAERPKGAPEPRHVSAAWLLQGKPTTMENFPSLPPA
RQQAILNGPGLAPPPGVVPNFVHPPNKTSMGVTIIAICLVLGTLTGLIRLYSRICVKKMHAEDVLGFAAYVSFVA
SGWSLLAFGHYGGFFVHQWNVQAKTMITISYVLYFFPIFYCATMLFAKTAILLEWTRIFVPVIRNSFYWISRVTT
IINVCLYLSVIVATSLYCVPVEKVWHKWVPGHCLNRKAVDTCVAVFNLGIDLLILALPQRIIWSLRIDTSKKIGV
SIVFSVGLLACACAIARTYLVIQLDFTGDVTYKLCETFMFAYSEMACVLMVFYVPASARAFKQNSLLSRMVSSLR
SWTRLPPSKKNRSAEDVGGQFPPTIGSKPINRVLHSADEETQALSLGEMRPAERFIVKTMEFEQREDAASKASTE
PELPNHRQHPWAKP
Coding >Ophio5|4523
ATGCTCGTCTCCACCAATGGCACGCCTCGCAGGCAGCTGGCCGATGCGGAACGGCCAGGTTCAAGGGGCTCTGAC
GACCGTCGACGCTCTCTCGAAGCAGTTCTGGACGGCTCCCAAACAGCAGAGAGGCCAAAAGGCGCCCCAGAGCCT
CGTCATGTCTCCGCCGCGTGGCTTCTCCAAGGCAAGCCAACGACAATGGAAAACTTCCCCAGCCTACCGCCCGCC
CGGCAACAAGCCATCCTCAACGGCCCCGGGCTGGCGCCGCCCCCGGGCGTTGTGCCCAACTTCGTCCACCCGCCG
AACAAGACATCCATGGGCGTCACCATCATTGCCATCTGCCTGGTCCTCGGCACACTGACGGGCCTCATCCGCTTG
TACTCGCGCATTTGCGTCAAAAAGATGCACGCCGAGGACGTCCTCGGCTTCGCGGCCTATGTTTCTTTCGTGGCC
TCGGGCTGGAGTCTGCTGGCCTTTGGACACTACGGCGGCTTCTTCGTGCATCAGTGGAACGTCCAGGCCAAGACG
ATGATAACCATTTCTTACGTCTTGTACTTCTTTCCCATCTTCTACTGCGCGACAATGCTCTTCGCCAAGACGGCC
ATCTTGCTCGAGTGGACGCGCATCTTTGTGCCCGTCATCCGGAACTCGTTCTACTGGATAAGCCGTGTGACTACC
ATCATCAATGTCTGCCTCTACTTGTCGGTCATCGTCGCCACCTCATTGTACTGTGTGCCGGTAGAAAAAGTCTGG
CACAAGTGGGTTCCGGGTCATTGCCTTAATCGCAAGGCTGTCGACACATGCGTCGCCGTCTTCAACCTTGGCATT
GATCTCCTGATATTGGCCCTGCCACAAAGGATCATCTGGTCCCTCAGGATCGACACCTCCAAAAAAATCGGCGTC
TCGATCGTCTTCTCCGTCGGATTGCTGGCTTGTGCCTGCGCCATCGCTCGAACGTACCTGGTGATCCAGCTGGAT
TTTACGGGCGACGTGACGTATAAGCTCTGCGAGACGTTCATGTTTGCCTACTCGGAAATGGCGTGTGTGCTCATG
GTCTTCTACGTGCCGGCGTCGGCGCGCGCCTTTAAGCAGAATAGCCTGCTGTCGAGGATGGTGTCGTCGCTGCGT
TCGTGGACGCGGCTGCCACCGTCGAAGAAGAACAGATCGGCCGAGGACGTCGGAGGGCAGTTCCCGCCGACGATC
GGCAGCAAGCCGATCAACCGCGTCCTTCACTCGGCCGACGAGGAGACGCAGGCGCTGAGCCTTGGCGAGATGAGG
CCGGCGGAGCGCTTCATCGTAAAAACTATGGAGTTTGAGCAGCGCGAAGACGCGGCATCCAAAGCATCGACAGAG
CCTGAGCTACCGAACCATAGACAACATCCTTGGGCGAAGCCG
Transcript >Ophio5|4523
ATGCTCGTCTCCACCAATGGCACGCCTCGCAGGCAGCTGGCCGATGCGGAACGGCCAGGTTCAAGGGGCTCTGAC
GACCGTCGACGCTCTCTCGAAGCAGTTCTGGACGGCTCCCAAACAGCAGAGAGGCCAAAAGGCGCCCCAGAGCCT
CGTCATGTCTCCGCCGCGTGGCTTCTCCAAGGCAAGCCAACGACAATGGAAAACTTCCCCAGCCTACCGCCCGCC
CGGCAACAAGCCATCCTCAACGGCCCCGGGCTGGCGCCGCCCCCGGGCGTTGTGCCCAACTTCGTCCACCCGCCG
AACAAGACATCCATGGGCGTCACCATCATTGCCATCTGCCTGGTCCTCGGCACACTGACGGGCCTCATCCGCTTG
TACTCGCGCATTTGCGTCAAAAAGATGCACGCCGAGGACGTCCTCGGCTTCGCGGCCTATGTTTCTTTCGTGGCC
TCGGGCTGGAGTCTGCTGGCCTTTGGACACTACGGCGGCTTCTTCGTGCATCAGTGGAACGTCCAGGCCAAGACG
ATGATAACCATTTCTTACGTCTTGTACTTCTTTCCCATCTTCTACTGCGCGACAATGCTCTTCGCCAAGACGGCC
ATCTTGCTCGAGTGGACGCGCATCTTTGTGCCCGTCATCCGGAACTCGTTCTACTGGATAAGCCGTGTGACTACC
ATCATCAATGTCTGCCTCTACTTGTCGGTCATCGTCGCCACCTCATTGTACTGTGTGCCGGTAGAAAAAGTCTGG
CACAAGTGGGTTCCGGGTCATTGCCTTAATCGCAAGGCTGTCGACACATGCGTCGCCGTCTTCAACCTTGGCATT
GATCTCCTGATATTGGCCCTGCCACAAAGGATCATCTGGTCCCTCAGGATCGACACCTCCAAAAAAATCGGCGTC
TCGATCGTCTTCTCCGTCGGATTGCTGGCTTGTGCCTGCGCCATCGCTCGAACGTACCTGGTGATCCAGCTGGAT
TTTACGGGCGACGTGACGTATAAGCTCTGCGAGACGTTCATGTTTGCCTACTCGGAAATGGCGTGTGTGCTCATG
GTCTTCTACGTGCCGGCGTCGGCGCGCGCCTTTAAGCAGAATAGCCTGCTGTCGAGGATGGTGTCGTCGCTGCGT
TCGTGGACGCGGCTGCCACCGTCGAAGAAGAACAGATCGGCCGAGGACGTCGGAGGGCAGTTCCCGCCGACGATC
GGCAGCAAGCCGATCAACCGCGTCCTTCACTCGGCCGACGAGGAGACGCAGGCGCTGAGCCTTGGCGAGATGAGG
CCGGCGGAGCGCTTCATCGTAAAAACTATGGAGTTTGAGCAGCGCGAAGACGCGGCATCCAAAGCATCGACAGAG
CCTGAGCTACCGAACCATAGACAACATCCTTGGGCGAAGCCGTAG
Gene >Ophio5|4523
ATGCTCGTCTCCACCAATGGCACGCCTCGCAGGCAGCTGGCCGATGCGGAACGGCCAGGTTCAAGGGTCAGGGTC
GCATCGGCAACCAAGCATCTGATAGTCAACGCTCATCAACCCCCCTGCAAGGTGGCCACCAGGGCTCTGACGACC
GTCGACGCTCTCTCGAAGCAGGCAAGGGTCCGGGTCAGCTCGCCCGCACGCCACTTGCTGACGCGCAGCTGCATC
TCTTGAAGTTCTGGACGGCTCCCAAACAGCAGAGAGGCCAAAAGGCGCCCCAGAGCCTCGTCATGTCTCCGCCGC
GTGGCTTCTCCAAGGCAAGCCAACGACAATGGAAAACTTCCCCAGCCTACCGCCCGCCCGGCAACAAGCCATCCT
CAACGGCCCCGGGCTGGCGCCGCCCCCGGGCGTTGTGCCCAACTTCGTCCACCCGCCGAACAAGACATCCATGGG
CGTCACCATCATTGCCATCTGCCTGGTCCTCGGCACACTGACGGGCCTCATCCGCTTGTACTCGCGCATTTGCGT
CAAAAAGATGCACGCCGAGGACGGTATGTGGCCAACCTTTACCGTACCTGCTCCGTGCTCACAGATGTGCCATCT
AGTCCTCGGCTTCGCGGCCTATGTATCGTCGCTCTACCCACCCCGTGTTTATGTCCCAAGCTCACCATGACAGGT
TTCTTTCGTGGCCTCGGGCTGGAGTCTGCTGGCCTTTGGACACTACGGCGGCTTCTTCGTGCATCAGTGGAACGT
CCAGGCCAAGACGATGATAACCATTTCTTACGTCGGTCATGGCCGACCCCCTCGCCATAAGAAGTGCCGGCTGAC
GTCGGACAGGTCTTGTACTTCTTTCCCATCTTCTACTGCGCGACAATGCTCTTCGCCAAGACGGCCATCTTGCTC
GAGTGGACGCGCATCTTTGTGCCCGTCATCCGGAACTCGTTCTACTGGATAAGCCGTGTGACTACCATCATCAAT
GTCTGCCTCTACTTGTCGGTCATCGTCGCCACCTCATTGTACTGTGTGCCGGTAGAAAAAGTCTGGCACAAGTGG
GTTCCGGGTCATTGCCTTAATCGCAAGGCTGTCGACACATGCGTCGCCGTCTTCAACCTTGGCATTGATCTCCTG
ATATTGGCCCTGCCACAAAGGATCATCTGGTCCCTCAGGATCGACACCTCCAAAAAAATCGGCGTCTCGATCGTC
TTCTCCGTCGGATTGCTGTAAGTCGTCTCGTCCGAGGTGATGGGCTTCAAGCTGACGAGATGGCCGGCCAGGGCT
TGTGCCTGCGCCATCGCTCGAACGTACCTGGTGATCCAGCTGGATTTTACGGGCGACGTGACGTATAAGCTCTGC
GAGACGTTCATGTTTGCCTACTCGGAAATGGCGTGTGTGCTCATGGTCTTCTACGTGCCGGCGTCGGCGCGCGCC
TTTAAGCAGAATAGCCTGCTGTCGAGGATGGTGTCGTCGCTGCGTTCGTGGACGCGGCTGCCACCGTCGAAGAAG
AACAGATCGGCCGAGGACGTCGGAGGGCAGTTCCCGCCGACGATCGGCAGCAAGCCGATCAACCGCGTCCTTCAC
TCGGCCGACGAGGAGACGCAGGCGCTGAGCCTTGGCGAGATGAGGCCGGCGGAGCGCTTCATCGTAAAAACTATG
GAGTTTGAGCAGCGCGAAGACGCGGCATCCAAAGCATCGACAGAGCCTGAGCTACCGAACCATAGACAACATCCT
TGGGCGAAGCCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail