Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4521
Gene name
Locationscaffold_36:16470..17353
Strand+
Gene length (bp)883
Transcript length (bp)678
Coding sequence length (bp)675
Protein length (aa) 225

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03959 FSH1 Serine hydrolase (FSH1) 5.5E-26 2 201

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13897|YF36_SCHPO Uncharacterized hydrolase C22A12.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22A12.06c PE=3 SV=1 2 200 2.0E-13
sp|Q18169|U483_CAEEL UPF0483 protein C25G4.2 OS=Caenorhabditis elegans GN=C25G4.2 PE=3 SV=1 1 199 3.0E-11
sp|Q94AC1|STR6_ARATH Rhodanese-like domain-containing protein 6 OS=Arabidopsis thaliana GN=STR6 PE=2 SV=1 1 199 3.0E-09
sp|Q61YZ4|U483_CAEBR UPF0483 protein CBG03338 OS=Caenorhabditis briggsae GN=CBG03338 PE=3 SV=1 1 210 3.0E-08
sp|Q9D7E3|OVCA2_MOUSE Ovarian cancer-associated gene 2 protein homolog OS=Mus musculus GN=Ovca2 PE=1 SV=1 1 205 2.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13897|YF36_SCHPO Uncharacterized hydrolase C22A12.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22A12.06c PE=3 SV=1 2 200 2.0E-13
sp|Q18169|U483_CAEEL UPF0483 protein C25G4.2 OS=Caenorhabditis elegans GN=C25G4.2 PE=3 SV=1 1 199 3.0E-11
sp|Q94AC1|STR6_ARATH Rhodanese-like domain-containing protein 6 OS=Arabidopsis thaliana GN=STR6 PE=2 SV=1 1 199 3.0E-09
sp|Q61YZ4|U483_CAEBR UPF0483 protein CBG03338 OS=Caenorhabditis briggsae GN=CBG03338 PE=3 SV=1 1 210 3.0E-08
sp|Q9D7E3|OVCA2_MOUSE Ovarian cancer-associated gene 2 protein homolog OS=Mus musculus GN=Ovca2 PE=1 SV=1 1 205 2.0E-07
sp|Q29BR3|U483_DROPS UPF0483 protein GA18864 OS=Drosophila pseudoobscura pseudoobscura GN=GA18864 PE=3 SV=1 1 205 5.0E-07
sp|Q3SZ07|OVCA2_BOVIN Ovarian cancer-associated gene 2 protein homolog OS=Bos taurus GN=OVCA2 PE=2 SV=1 1 205 2.0E-06
sp|Q9VDL1|U483_DROME UPF0483 protein CG5412 OS=Drosophila melanogaster GN=CG5412 PE=2 SV=1 1 205 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4521
MRFLCLHGRGTDAEIFKSQTARLREALGQEHEYVFVNGNVRARARAGLTPDTAYGPQGLGFWPLDDPDEHRTRRV
YHDLVAFIASRGPFDGLMAFSEGASVAATLMTELARPDSQEPVPGIRCAVFFCGLPPLNLQLRQTDRPIALLDSA
VDGVSVRVPTAHIWSSAGQVLPDAGRHLAALCDPDTREELIHDLGHQVPGSLSEKGLRQTVRVIERTLERAKSSS
Coding >Ophio5|4521
ATGCGCTTCTTGTGCCTCCATGGCCGCGGCACTGATGCCGAGATCTTCAAGAGCCAGACCGCTCGCCTCCGCGAG
GCCCTCGGCCAAGAGCACGAATATGTCTTCGTCAACGGCAATGTCCGGGCCAGGGCCCGCGCCGGACTCACACCC
GATACCGCCTATGGCCCTCAAGGCCTCGGCTTCTGGCCCCTGGATGATCCCGACGAGCACCGCACGCGCCGCGTC
TACCATGACCTAGTAGCCTTCATCGCCTCGCGCGGCCCCTTCGACGGTCTCATGGCCTTTTCTGAAGGAGCCAGC
GTTGCCGCTACCCTCATGACCGAGCTCGCCCGCCCCGACTCCCAAGAGCCCGTTCCTGGCATCCGCTGCGCCGTC
TTTTTCTGCGGCCTTCCGCCGCTCAACCTTCAGCTGCGTCAGACCGACCGCCCCATCGCTCTGCTCGATTCGGCA
GTCGATGGCGTCTCGGTCCGCGTGCCCACGGCCCACATCTGGTCCAGCGCCGGTCAGGTATTGCCGGACGCGGGC
AGGCATTTGGCGGCGCTGTGTGACCCGGACACTCGAGAGGAGCTGATTCACGATCTGGGCCACCAAGTCCCCGGC
TCTCTGTCCGAGAAAGGTCTGCGACAGACCGTTCGCGTCATCGAGCGCACGCTCGAAAGGGCCAAGTCGAGCTCG
Transcript >Ophio5|4521
ATGCGCTTCTTGTGCCTCCATGGCCGCGGCACTGATGCCGAGATCTTCAAGAGCCAGACCGCTCGCCTCCGCGAG
GCCCTCGGCCAAGAGCACGAATATGTCTTCGTCAACGGCAATGTCCGGGCCAGGGCCCGCGCCGGACTCACACCC
GATACCGCCTATGGCCCTCAAGGCCTCGGCTTCTGGCCCCTGGATGATCCCGACGAGCACCGCACGCGCCGCGTC
TACCATGACCTAGTAGCCTTCATCGCCTCGCGCGGCCCCTTCGACGGTCTCATGGCCTTTTCTGAAGGAGCCAGC
GTTGCCGCTACCCTCATGACCGAGCTCGCCCGCCCCGACTCCCAAGAGCCCGTTCCTGGCATCCGCTGCGCCGTC
TTTTTCTGCGGCCTTCCGCCGCTCAACCTTCAGCTGCGTCAGACCGACCGCCCCATCGCTCTGCTCGATTCGGCA
GTCGATGGCGTCTCGGTCCGCGTGCCCACGGCCCACATCTGGTCCAGCGCCGGTCAGGTATTGCCGGACGCGGGC
AGGCATTTGGCGGCGCTGTGTGACCCGGACACTCGAGAGGAGCTGATTCACGATCTGGGCCACCAAGTCCCCGGC
TCTCTGTCCGAGAAAGGTCTGCGACAGACCGTTCGCGTCATCGAGCGCACGCTCGAAAGGGCCAAGTCGAGCTCG
TGA
Gene >Ophio5|4521
ATGCGCTTCTTGTGCCTCCATGGCCGCGGCACTGATGCCGAGGTGAGTCGTCTCGCTCGCTCGCCTCCCGCGACT
GCTTGTCTCAAGCTGCTGACCAATATCACCAGATCTTCAAGAGCCAGACCGGTCTGTCGCCTAATGGAAATGAAC
CCCCTTGCTGGTCTCTCCGCTGATCGAGGCCAGCTCGCCTCCGCGAGGCCCTCGGCCAAGAGCACGAATATGTCT
TCGTCAACGGCAATGTCCGGGCCAGGGCCCGCGCCGGTGCGCCCTTTCTCTCTCCCCCTCTCTCACTCTCGTGTG
TGCAAGGCAAGTGCTGAGCGCCCCTGACGTCCCACCCATCTCAGGACTCACACCCGATACCGCCTATGGCCCTCA
AGGCCTCGGCTTCTGGCCCCTGGATGATCCCGACGAGCACCGCACGCGCCGCGTCTACCATGACCTAGTAGCCTT
CATCGCCTCGCGCGGCCCCTTCGACGGTCTCATGGCCTTTTCTGAAGGAGCCAGCGTTGCCGCTACCCTCATGAC
CGAGCTCGCCCGCCCCGACTCCCAAGAGCCCGTTCCTGGCATCCGCTGCGCCGTCTTTTTCTGCGGCCTTCCGCC
GCTCAACCTTCAGCTGCGTCAGACCGACCGCCCCATCGCTCTGCTCGATTCGGCAGTCGATGGCGTCTCGGTCCG
CGTGCCCACGGCCCACATCTGGTCCAGCGCCGGTCAGGTATTGCCGGACGCGGGCAGGCATTTGGCGGCGCTGTG
TGACCCGGACACTCGAGAGGAGCTGATTCACGATCTGGGCCACCAAGTCCCCGGCTCTCTGTCCGAGAAAGGTCT
GCGACAGACCGTTCGCGTCATCGAGCGCACGCTCGAAAGGGCCAAGTCGAGCTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail