Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4518
Gene name
Locationscaffold_359:18857..20149
Strand-
Gene length (bp)1292
Transcript length (bp)1125
Coding sequence length (bp)1122
Protein length (aa) 374

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07970 COPIIcoated_ERV Endoplasmic reticulum vesicle transporter 2.2E-34 181 338
PF13850 ERGIC_N Endoplasmic Reticulum-Golgi Intermediate Compartment (ERGIC) 1.4E-21 22 108

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94283|ERV41_SCHPO ER-derived vesicles protein 41 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erv41 PE=1 SV=1 21 367 4.0E-43
sp|Q04651|ERV41_YEAST ER-derived vesicles protein ERV41 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERV41 PE=1 SV=1 21 347 3.0E-42
sp|Q4R5C3|ERGI2_MACFA Endoplasmic reticulum-Golgi intermediate compartment protein 2 OS=Macaca fascicularis GN=ERGIC2 PE=2 SV=1 19 374 5.0E-39
sp|Q5EHU7|ERGI2_GECJA Endoplasmic reticulum-Golgi intermediate compartment protein 2 OS=Gecko japonicus GN=ERGIC2 PE=2 SV=1 19 374 7.0E-39
sp|Q96RQ1|ERGI2_HUMAN Endoplasmic reticulum-Golgi intermediate compartment protein 2 OS=Homo sapiens GN=ERGIC2 PE=1 SV=2 19 374 4.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94283|ERV41_SCHPO ER-derived vesicles protein 41 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erv41 PE=1 SV=1 21 367 4.0E-43
sp|Q04651|ERV41_YEAST ER-derived vesicles protein ERV41 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERV41 PE=1 SV=1 21 347 3.0E-42
sp|Q4R5C3|ERGI2_MACFA Endoplasmic reticulum-Golgi intermediate compartment protein 2 OS=Macaca fascicularis GN=ERGIC2 PE=2 SV=1 19 374 5.0E-39
sp|Q5EHU7|ERGI2_GECJA Endoplasmic reticulum-Golgi intermediate compartment protein 2 OS=Gecko japonicus GN=ERGIC2 PE=2 SV=1 19 374 7.0E-39
sp|Q96RQ1|ERGI2_HUMAN Endoplasmic reticulum-Golgi intermediate compartment protein 2 OS=Homo sapiens GN=ERGIC2 PE=1 SV=2 19 374 4.0E-38
sp|Q9CR89|ERGI2_MOUSE Endoplasmic reticulum-Golgi intermediate compartment protein 2 OS=Mus musculus GN=Ergic2 PE=1 SV=1 19 358 1.0E-37
sp|Q803I2|ERGI3_DANRE Endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Danio rerio GN=ergic3 PE=2 SV=1 21 355 3.0E-37
sp|Q66KH2|ERGI3_XENLA Endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Xenopus laevis GN=ergic3 PE=2 SV=1 24 339 1.0E-35
sp|Q6NVS2|ERGI3_XENTR Endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Xenopus tropicalis GN=ergic3 PE=2 SV=1 24 339 2.0E-35
sp|Q7T2D4|ERGI2_DANRE Endoplasmic reticulum-Golgi intermediate compartment protein 2 OS=Danio rerio GN=ergic2 PE=2 SV=1 21 336 5.0E-33
sp|Q9Y282|ERGI3_HUMAN Endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Homo sapiens GN=ERGIC3 PE=1 SV=1 21 355 3.0E-31
sp|Q4R8X1|ERGI3_MACFA Endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Macaca fascicularis GN=ERGIC3 PE=2 SV=1 21 355 5.0E-31
sp|Q5R8G3|ERGI3_PONAB Endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Pongo abelii GN=ERGIC3 PE=2 SV=1 21 355 1.0E-30
sp|Q54DW2|ERGI3_DICDI Probable endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Dictyostelium discoideum GN=ergic3 PE=3 SV=1 19 338 1.0E-30
sp|Q9CQE7|ERGI3_MOUSE Endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Mus musculus GN=Ergic3 PE=1 SV=1 21 355 2.0E-30
sp|Q5EAE0|ERGI3_BOVIN Endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Bos taurus GN=ERGIC3 PE=2 SV=1 21 355 4.0E-29
sp|Q09895|YAI8_SCHPO Uncharacterized protein C24B11.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24B11.08c PE=3 SV=1 19 341 1.0E-16
sp|P39727|ERV46_YEAST ER-derived vesicles protein ERV46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERV46 PE=1 SV=2 17 339 6.0E-14
sp|Q969X5|ERGI1_HUMAN Endoplasmic reticulum-Golgi intermediate compartment protein 1 OS=Homo sapiens GN=ERGIC1 PE=1 SV=1 178 339 8.0E-07
sp|Q6NS19|ERGI1_XENLA Endoplasmic reticulum-Golgi intermediate compartment protein 1 OS=Xenopus laevis GN=ergic1 PE=2 SV=1 189 357 1.0E-06
sp|Q4V8Y6|ERGI1_DANRE Endoplasmic reticulum-Golgi intermediate compartment protein 1 OS=Danio rerio GN=ergic1 PE=2 SV=1 189 339 1.0E-06
sp|Q9DC16|ERGI1_MOUSE Endoplasmic reticulum-Golgi intermediate compartment protein 1 OS=Mus musculus GN=Ergic1 PE=1 SV=1 178 339 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4518
MNGFEKHGLDEDRFGAKGSVVSAFDAFPKSKPQYVTRTSGGGKWTVAMGLVSMMLLWSEMARWWRGSETHAFAVE
KGVSQSMQINLDAVVRMQCGDLNINVQDAAGDRIRAGTRLRLDQTSWSQWINAKGIHQLGRDSDGRIITGAGWQS
LAHGEEGFGEEHVHDIVAAGKRRARWAKTPRVHGAPDSCRIYGSLELNKVQGDFHITARGHGYIEGGDHLDHGKF
NFSHIISELSYGPFYPSLVNPLDRTVNGAKANFHKFQYFLSVVPTVYSVGSSSIVTNQYAVTEQSAEINEMSVPG
IFFKYDIEPILLSVQENRDGILVFLVKLINVLSGVLVAGHWGFTLTEWVREVRGKRRRSAAGEGVLGNKNGYED
Coding >Ophio5|4518
ATGAATGGCTTCGAAAAGCATGGCCTCGACGAGGACCGCTTCGGCGCAAAGGGCAGCGTAGTCAGCGCCTTTGAT
GCCTTCCCCAAGTCGAAACCGCAGTATGTGACGAGGACGTCCGGCGGCGGCAAGTGGACCGTGGCCATGGGCCTG
GTGTCGATGATGCTGTTATGGAGCGAGATGGCTCGCTGGTGGCGCGGGTCCGAGACGCATGCCTTTGCTGTCGAA
AAGGGCGTTTCGCAATCGATGCAGATAAACCTTGACGCCGTCGTGCGGATGCAGTGCGGCGATCTCAACATCAAC
GTCCAGGATGCTGCCGGCGATCGCATCCGTGCCGGCACGCGGTTACGGCTCGACCAGACGAGCTGGAGTCAGTGG
ATAAACGCCAAGGGCATCCACCAGCTTGGCCGCGATAGCGACGGCCGTATCATCACCGGCGCCGGGTGGCAGAGT
CTGGCTCATGGCGAGGAGGGCTTCGGAGAGGAGCACGTCCATGACATTGTCGCAGCAGGCAAGAGGAGGGCACGC
TGGGCCAAGACGCCTAGGGTTCACGGCGCGCCCGACAGCTGCCGCATATACGGGAGTCTCGAGTTGAACAAGGTC
CAGGGCGACTTTCACATCACCGCCCGAGGTCACGGCTACATCGAGGGCGGCGACCATCTGGACCATGGCAAGTTC
AACTTCTCGCACATCATCTCAGAACTATCCTACGGCCCCTTTTACCCCTCTCTCGTCAACCCGCTCGACCGGACC
GTCAACGGGGCCAAGGCCAACTTCCACAAGTTCCAGTACTTTCTGTCCGTCGTGCCGACCGTCTACAGCGTCGGT
TCGAGCTCCATCGTGACGAACCAGTACGCGGTGACGGAGCAGAGCGCCGAGATCAACGAGATGTCCGTCCCGGGC
ATCTTCTTTAAGTACGACATTGAACCCATATTGCTGTCGGTGCAGGAGAACCGCGACGGCATTCTCGTCTTTCTC
GTCAAGCTCATCAACGTCCTCAGTGGTGTTCTCGTCGCCGGTCACTGGGGTTTTACTCTCACTGAGTGGGTGCGA
GAGGTCCGCGGCAAGCGTCGACGGAGCGCGGCCGGTGAGGGCGTCTTGGGTAACAAGAATGGCTACGAAGAT
Transcript >Ophio5|4518
ATGAATGGCTTCGAAAAGCATGGCCTCGACGAGGACCGCTTCGGCGCAAAGGGCAGCGTAGTCAGCGCCTTTGAT
GCCTTCCCCAAGTCGAAACCGCAGTATGTGACGAGGACGTCCGGCGGCGGCAAGTGGACCGTGGCCATGGGCCTG
GTGTCGATGATGCTGTTATGGAGCGAGATGGCTCGCTGGTGGCGCGGGTCCGAGACGCATGCCTTTGCTGTCGAA
AAGGGCGTTTCGCAATCGATGCAGATAAACCTTGACGCCGTCGTGCGGATGCAGTGCGGCGATCTCAACATCAAC
GTCCAGGATGCTGCCGGCGATCGCATCCGTGCCGGCACGCGGTTACGGCTCGACCAGACGAGCTGGAGTCAGTGG
ATAAACGCCAAGGGCATCCACCAGCTTGGCCGCGATAGCGACGGCCGTATCATCACCGGCGCCGGGTGGCAGAGT
CTGGCTCATGGCGAGGAGGGCTTCGGAGAGGAGCACGTCCATGACATTGTCGCAGCAGGCAAGAGGAGGGCACGC
TGGGCCAAGACGCCTAGGGTTCACGGCGCGCCCGACAGCTGCCGCATATACGGGAGTCTCGAGTTGAACAAGGTC
CAGGGCGACTTTCACATCACCGCCCGAGGTCACGGCTACATCGAGGGCGGCGACCATCTGGACCATGGCAAGTTC
AACTTCTCGCACATCATCTCAGAACTATCCTACGGCCCCTTTTACCCCTCTCTCGTCAACCCGCTCGACCGGACC
GTCAACGGGGCCAAGGCCAACTTCCACAAGTTCCAGTACTTTCTGTCCGTCGTGCCGACCGTCTACAGCGTCGGT
TCGAGCTCCATCGTGACGAACCAGTACGCGGTGACGGAGCAGAGCGCCGAGATCAACGAGATGTCCGTCCCGGGC
ATCTTCTTTAAGTACGACATTGAACCCATATTGCTGTCGGTGCAGGAGAACCGCGACGGCATTCTCGTCTTTCTC
GTCAAGCTCATCAACGTCCTCAGTGGTGTTCTCGTCGCCGGTCACTGGGGTTTTACTCTCACTGAGTGGGTGCGA
GAGGTCCGCGGCAAGCGTCGACGGAGCGCGGCCGGTGAGGGCGTCTTGGGTAACAAGAATGGCTACGAAGATTAG
Gene >Ophio5|4518
ATGAATGGCTTCGAAAAGCATGGCCTCGACGAGGACCGCTTCGGCGCAAAGGGCAGCGTAGTCAGCGCCTTTGAT
GCCTTCCGTGAGCAGCCTCCCCATCTTCTCTCTTGCTACACGCGACTCCCTTCTAACGACATGTGGCGGGAGGCA
AACCTCAGCCAAGTCGAAACCGCAGTATGTGACGAGGACGTCCGGCGGCGGCAAGTGGACCGTGGCCATGGGCCT
GGTGTCGATGATGCTGTTATGGAGCGAGATGGCTCGCTGGTGGCGCGGGTCCGAGACGCATGCCTTTGCTGTCGA
AAAGGGCGTTTCGCAATCGATGCAGATAAACCTTGACGCCGTCGTGCGGATGCAGTGCGGCGATCTCAACATCAA
CGTCCAGGATGCTGCCGGCGATCGCATCCGTGCCGGCACGCGGTTACGGCTCGACCAGACGAGCTGGAGTCAGTG
GATAAACGCCAAGGGCATCCACCAGCTTGGCCGCGATAGCGACGGCCGTATCATCACCGGCGCCGGGTGGCAGAG
TCTGGCTCATGGCGAGGAGGGCTTCGGAGAGGAGCACGTCCATGACATTGTCGCAGCAGGCAAGAGGAGGGCACG
CTGGGCCAAGACGCCTAGGGTTCACGGCGCGCCCGACAGCTGCCGCATATACGGGAGTCTCGAGTTGAACAAGGT
CCAGGGCGACTTTCACATCACCGCCCGAGGTCACGGCTACATCGAGGGCGGCGACCATCTGGACCATGGCAGTGC
GTTATCTTGCCCAGTACTTCTTTTTCCATCCTCTCGATTTTTCCGTGCCCTATCTCAACGTGGCTGACTGTAATC
TTTCCGGCGCAGAGTTCAACTTCTCGCACATCATCTCAGAACTATCCTACGGCCCCTTTTACCCCTCTCTCGTCA
ACCCGCTCGACCGGACCGTCAACGGGGCCAAGGCCAACTTCCACAAGTTCCAGTACTTTCTGTCCGTCGTGCCGA
CCGTCTACAGCGTCGGTTCGAGCTCCATCGTGACGAACCAGTACGCGGTGACGGAGCAGAGCGCCGAGATCAACG
AGATGTCCGTCCCGGGCATCTTCTTTAAGTACGACATTGAACCCATATTGCTGTCGGTGCAGGAGAACCGCGACG
GCATTCTCGTCTTTCTCGTCAAGCTCATCAACGTCCTCAGTGGTGTTCTCGTCGCCGGTCACTGGGGTTTTACTC
TCACTGAGTGGGTGCGAGAGGTCCGCGGCAAGCGTCGACGGAGCGCGGCCGGTGAGGGCGTCTTGGGTAACAAGA
ATGGCTACGAAGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail