Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4516
Gene name
Locationscaffold_359:14785..16393
Strand+
Gene length (bp)1608
Transcript length (bp)1608
Coding sequence length (bp)1605
Protein length (aa) 535

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 5120.34 140.53 10100.20
CcL In ants, during behavior modification 684.94 209.36 1160.53
CcD In ants, recently dead 4401.75 505.26 8298.24

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.780139 no
CcL CcD 0.000286 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4516
MNKCASVLAGFAVINGALAALKPDSPVINTPGYRDACHQDGYPASGPNYPCNEAIEYRAVCDQISDMKMHQECVC
EPWYRANEDGCIECKDLHGLDGPVGTKYWRNIMEKALDGYCKEKNPATKFGDFWAGVRNSAGEIPQHGKDNVPNN
VLGQDISVSRYFKNVPAKPDMSKYLKGSAPTGTVSLLPSSVVVMATQTAEPSPAATTLVPKPKYPSNHTMSVTSS
VEVSVKAKVTLYTVGYNCAAILRGEAGVRYNCGNPHYVPNAKIEAVSVVDLEANIVANFPDPSFCGCIENQLIVG
QKFILENSTEGRSGYTALKPSADHKKLVVDEKRTSDKPLPGAGPRSFEETGLPTYPASVKSQVDCVPGSKKGSAP
KKAETPGSGKEFSASASASASASASVSGSGSAHAHAHAHASVTIAQQGNAQVYVPSSSVKNGAVVAAGAAASLPN
TVPQVPAGPAKGSSPAGSKGSSPAGSKGSSPAGSASSPVHPAGTGAPVPPSAPRHGPADAVSVSGAAAMSVPALA
LAAGIMVAAF
Coding >Ophio5|4516
ATGAACAAGTGCGCCTCCGTCCTCGCCGGCTTCGCCGTCATCAACGGCGCTCTGGCCGCCCTCAAGCCCGACTCA
CCCGTCATCAACACGCCTGGATACCGGGATGCCTGCCACCAAGACGGTTACCCTGCCTCGGGGCCTAACTACCCT
TGCAACGAGGCCATTGAGTACCGCGCCGTGTGCGATCAGATCTCCGACATGAAGATGCATCAGGAGTGTGTTTGC
GAGCCTTGGTATCGCGCCAACGAAGACGGCTGCATCGAGTGCAAGGACTTGCATGGTCTCGACGGCCCCGTCGGC
ACCAAGTACTGGAGGAACATCATGGAGAAGGCCCTTGACGGTTACTGCAAGGAGAAGAACCCTGCCACCAAGTTT
GGCGACTTCTGGGCTGGTGTTAGGAACTCAGCCGGCGAGATCCCCCAGCACGGCAAGGATAACGTGCCCAACAAT
GTCCTGGGTCAGGACATCAGCGTCTCTCGCTACTTCAAGAACGTCCCGGCCAAGCCCGACATGTCCAAGTACCTG
AAGGGCTCGGCCCCGACGGGAACCGTCTCTCTTCTCCCGTCTTCGGTTGTCGTCATGGCTACCCAGACGGCCGAG
CCCTCCCCTGCGGCCACGACGCTGGTCCCCAAGCCCAAGTACCCCTCTAACCACACCATGTCCGTGACGTCTTCT
GTCGAGGTTTCCGTCAAGGCCAAGGTTACTCTCTACACTGTCGGATACAACTGCGCTGCCATTCTCAGGGGCGAG
GCCGGCGTCAGGTACAACTGCGGAAACCCTCACTACGTGCCCAATGCCAAGATCGAGGCCGTCTCTGTTGTTGAC
CTCGAGGCCAACATTGTGGCCAACTTCCCTGACCCCAGCTTCTGCGGCTGCATTGAGAACCAGCTCATCGTCGGC
CAGAAGTTCATCCTTGAGAACTCTACCGAGGGTCGCTCTGGCTACACTGCCCTCAAGCCTTCCGCGGACCACAAG
AAGCTCGTCGTTGACGAGAAGCGCACTTCGGACAAGCCTCTGCCCGGTGCTGGCCCTCGGAGCTTCGAGGAGACT
GGCCTCCCGACTTACCCTGCCAGCGTCAAGTCTCAAGTCGATTGCGTTCCCGGCTCCAAGAAGGGCTCTGCTCCC
AAGAAGGCTGAGACCCCTGGTTCTGGCAAGGAGTTCTCTGCCTCTGCCTCTGCCTCTGCTTCGGCCTCTGCTTCC
GTCTCTGGCTCCGGCTCCGCCCACGCCCACGCCCACGCCCACGCTTCTGTCACCATCGCCCAGCAGGGCAACGCC
CAAGTCTACGTGCCGTCATCCAGTGTCAAGAATGGCGCCGTCGTCGCGGCCGGTGCTGCCGCCAGCCTGCCCAAC
ACCGTTCCTCAGGTCCCGGCTGGCCCTGCCAAGGGTTCTTCTCCTGCCGGCTCCAAGGGTTCTTCTCCCGCCGGC
TCTAAGGGTTCTTCTCCCGCCGGTTCCGCTTCCTCTCCGGTCCACCCTGCCGGCACCGGCGCACCTGTTCCCCCC
TCGGCCCCCCGCCATGGACCTGCCGACGCTGTGAGCGTCAGCGGCGCTGCTGCCATGAGCGTCCCTGCTCTGGCC
CTCGCCGCCGGCATCATGGTTGCCGCCTTC
Transcript >Ophio5|4516
ATGAACAAGTGCGCCTCCGTCCTCGCCGGCTTCGCCGTCATCAACGGCGCTCTGGCCGCCCTCAAGCCCGACTCA
CCCGTCATCAACACGCCTGGATACCGGGATGCCTGCCACCAAGACGGTTACCCTGCCTCGGGGCCTAACTACCCT
TGCAACGAGGCCATTGAGTACCGCGCCGTGTGCGATCAGATCTCCGACATGAAGATGCATCAGGAGTGTGTTTGC
GAGCCTTGGTATCGCGCCAACGAAGACGGCTGCATCGAGTGCAAGGACTTGCATGGTCTCGACGGCCCCGTCGGC
ACCAAGTACTGGAGGAACATCATGGAGAAGGCCCTTGACGGTTACTGCAAGGAGAAGAACCCTGCCACCAAGTTT
GGCGACTTCTGGGCTGGTGTTAGGAACTCAGCCGGCGAGATCCCCCAGCACGGCAAGGATAACGTGCCCAACAAT
GTCCTGGGTCAGGACATCAGCGTCTCTCGCTACTTCAAGAACGTCCCGGCCAAGCCCGACATGTCCAAGTACCTG
AAGGGCTCGGCCCCGACGGGAACCGTCTCTCTTCTCCCGTCTTCGGTTGTCGTCATGGCTACCCAGACGGCCGAG
CCCTCCCCTGCGGCCACGACGCTGGTCCCCAAGCCCAAGTACCCCTCTAACCACACCATGTCCGTGACGTCTTCT
GTCGAGGTTTCCGTCAAGGCCAAGGTTACTCTCTACACTGTCGGATACAACTGCGCTGCCATTCTCAGGGGCGAG
GCCGGCGTCAGGTACAACTGCGGAAACCCTCACTACGTGCCCAATGCCAAGATCGAGGCCGTCTCTGTTGTTGAC
CTCGAGGCCAACATTGTGGCCAACTTCCCTGACCCCAGCTTCTGCGGCTGCATTGAGAACCAGCTCATCGTCGGC
CAGAAGTTCATCCTTGAGAACTCTACCGAGGGTCGCTCTGGCTACACTGCCCTCAAGCCTTCCGCGGACCACAAG
AAGCTCGTCGTTGACGAGAAGCGCACTTCGGACAAGCCTCTGCCCGGTGCTGGCCCTCGGAGCTTCGAGGAGACT
GGCCTCCCGACTTACCCTGCCAGCGTCAAGTCTCAAGTCGATTGCGTTCCCGGCTCCAAGAAGGGCTCTGCTCCC
AAGAAGGCTGAGACCCCTGGTTCTGGCAAGGAGTTCTCTGCCTCTGCCTCTGCCTCTGCTTCGGCCTCTGCTTCC
GTCTCTGGCTCCGGCTCCGCCCACGCCCACGCCCACGCCCACGCTTCTGTCACCATCGCCCAGCAGGGCAACGCC
CAAGTCTACGTGCCGTCATCCAGTGTCAAGAATGGCGCCGTCGTCGCGGCCGGTGCTGCCGCCAGCCTGCCCAAC
ACCGTTCCTCAGGTCCCGGCTGGCCCTGCCAAGGGTTCTTCTCCTGCCGGCTCCAAGGGTTCTTCTCCCGCCGGC
TCTAAGGGTTCTTCTCCCGCCGGTTCCGCTTCCTCTCCGGTCCACCCTGCCGGCACCGGCGCACCTGTTCCCCCC
TCGGCCCCCCGCCATGGACCTGCCGACGCTGTGAGCGTCAGCGGCGCTGCTGCCATGAGCGTCCCTGCTCTGGCC
CTCGCCGCCGGCATCATGGTTGCCGCCTTCTAA
Gene >Ophio5|4516
ATGAACAAGTGCGCCTCCGTCCTCGCCGGCTTCGCCGTCATCAACGGCGCTCTGGCCGCCCTCAAGCCCGACTCA
CCCGTCATCAACACGCCTGGATACCGGGATGCCTGCCACCAAGACGGTTACCCTGCCTCGGGGCCTAACTACCCT
TGCAACGAGGCCATTGAGTACCGCGCCGTGTGCGATCAGATCTCCGACATGAAGATGCATCAGGAGTGTGTTTGC
GAGCCTTGGTATCGCGCCAACGAAGACGGCTGCATCGAGTGCAAGGACTTGCATGGTCTCGACGGCCCCGTCGGC
ACCAAGTACTGGAGGAACATCATGGAGAAGGCCCTTGACGGTTACTGCAAGGAGAAGAACCCTGCCACCAAGTTT
GGCGACTTCTGGGCTGGTGTTAGGAACTCAGCCGGCGAGATCCCCCAGCACGGCAAGGATAACGTGCCCAACAAT
GTCCTGGGTCAGGACATCAGCGTCTCTCGCTACTTCAAGAACGTCCCGGCCAAGCCCGACATGTCCAAGTACCTG
AAGGGCTCGGCCCCGACGGGAACCGTCTCTCTTCTCCCGTCTTCGGTTGTCGTCATGGCTACCCAGACGGCCGAG
CCCTCCCCTGCGGCCACGACGCTGGTCCCCAAGCCCAAGTACCCCTCTAACCACACCATGTCCGTGACGTCTTCT
GTCGAGGTTTCCGTCAAGGCCAAGGTTACTCTCTACACTGTCGGATACAACTGCGCTGCCATTCTCAGGGGCGAG
GCCGGCGTCAGGTACAACTGCGGAAACCCTCACTACGTGCCCAATGCCAAGATCGAGGCCGTCTCTGTTGTTGAC
CTCGAGGCCAACATTGTGGCCAACTTCCCTGACCCCAGCTTCTGCGGCTGCATTGAGAACCAGCTCATCGTCGGC
CAGAAGTTCATCCTTGAGAACTCTACCGAGGGTCGCTCTGGCTACACTGCCCTCAAGCCTTCCGCGGACCACAAG
AAGCTCGTCGTTGACGAGAAGCGCACTTCGGACAAGCCTCTGCCCGGTGCTGGCCCTCGGAGCTTCGAGGAGACT
GGCCTCCCGACTTACCCTGCCAGCGTCAAGTCTCAAGTCGATTGCGTTCCCGGCTCCAAGAAGGGCTCTGCTCCC
AAGAAGGCTGAGACCCCTGGTTCTGGCAAGGAGTTCTCTGCCTCTGCCTCTGCCTCTGCTTCGGCCTCTGCTTCC
GTCTCTGGCTCCGGCTCCGCCCACGCCCACGCCCACGCCCACGCTTCTGTCACCATCGCCCAGCAGGGCAACGCC
CAAGTCTACGTGCCGTCATCCAGTGTCAAGAATGGCGCCGTCGTCGCGGCCGGTGCTGCCGCCAGCCTGCCCAAC
ACCGTTCCTCAGGTCCCGGCTGGCCCTGCCAAGGGTTCTTCTCCTGCCGGCTCCAAGGGTTCTTCTCCCGCCGGC
TCTAAGGGTTCTTCTCCCGCCGGTTCCGCTTCCTCTCCGGTCCACCCTGCCGGCACCGGCGCACCTGTTCCCCCC
TCGGCCCCCCGCCATGGACCTGCCGACGCTGTGAGCGTCAGCGGCGCTGCTGCCATGAGCGTCCCTGCTCTGGCC
CTCGCCGCCGGCATCATGGTTGCCGCCTTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail