Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4515
Gene name
Locationscaffold_359:12680..13322
Strand-
Gene length (bp)642
Transcript length (bp)504
Coding sequence length (bp)501
Protein length (aa) 167

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 4 26 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 13.64 3.22 24.05
CcL In ants, during behavior modification 10.10 1.02 19.17
CcD In ants, recently dead 12.11 2.55 21.68

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.516289 no
SC16a CcD 0.805199 no
CcL CcD 0.713627 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4515
MTDLRLLACYAISMSMSAIFTAASLREWRRKQFSKRVERMENCRAKECSLRRGIRSYYRVSKYYHHYIITRTLGP
IEQSTRNLLALLTHWIPLQATIDGLTHSTSSSSPVTVVCGRKGLTGRILYQLIFTLFPVVNRTGEAKGSPSCYSV
ECHTGRFVDVSGLKSPS
Coding >Ophio5|4515
ATGACAGACCTGCGTCTCCTTGCATGCTATGCTATTTCTATGTCCATGTCTGCCATCTTTACAGCTGCCTCATTA
CGCGAGTGGAGACGCAAACAATTTTCAAAGCGGGTGGAGCGGATGGAAAACTGCCGCGCTAAGGAATGTTCTTTA
CGTCGCGGAATCCGCTCCTACTACCGCGTTTCCAAGTACTACCATCACTATATTATCACCCGTACCCTCGGTCCC
ATCGAGCAAAGCACTAGAAACTTGCTCGCGCTGCTCACACACTGGATCCCCCTACAGGCAACTATTGACGGCCTG
ACGCACTCCACGTCCTCCTCATCACCGGTCACCGTAGTATGCGGAAGGAAGGGCCTTACCGGCCGGATCTTATAT
CAGCTCATATTTACGCTTTTTCCGGTGGTGAATCGAACAGGTGAAGCAAAGGGATCTCCCAGTTGCTATTCCGTA
GAATGCCATACCGGGCGCTTTGTTGATGTCAGTGGATTAAAGTCACCTTCA
Transcript >Ophio5|4515
ATGACAGACCTGCGTCTCCTTGCATGCTATGCTATTTCTATGTCCATGTCTGCCATCTTTACAGCTGCCTCATTA
CGCGAGTGGAGACGCAAACAATTTTCAAAGCGGGTGGAGCGGATGGAAAACTGCCGCGCTAAGGAATGTTCTTTA
CGTCGCGGAATCCGCTCCTACTACCGCGTTTCCAAGTACTACCATCACTATATTATCACCCGTACCCTCGGTCCC
ATCGAGCAAAGCACTAGAAACTTGCTCGCGCTGCTCACACACTGGATCCCCCTACAGGCAACTATTGACGGCCTG
ACGCACTCCACGTCCTCCTCATCACCGGTCACCGTAGTATGCGGAAGGAAGGGCCTTACCGGCCGGATCTTATAT
CAGCTCATATTTACGCTTTTTCCGGTGGTGAATCGAACAGGTGAAGCAAAGGGATCTCCCAGTTGCTATTCCGTA
GAATGCCATACCGGGCGCTTTGTTGATGTCAGTGGATTAAAGTCACCTTCATAG
Gene >Ophio5|4515
ATGACAGACCTGCGTCTCCTTGCATGCTATGCTATTTCTATGTCCATGTCTGCCATCTTTACAGCTGCCTCATGT
ATGCTGCATGTATGTATATTGTCTCTATACTTGTGGCATCGCTCAGTACGCGAGTGGAGACGCAAACAATTTTCA
AAGCGGGTGGAGCGGATGGAAAACTGCCGCGCTAAGGAATGTTCTTTACGTCGCGGAATCCGCTCCTACTACCGC
GTTTCCAAGTACTACCATCACTATATTATCACCCGTACCCTCGGTCCCATCGAGCAAAGCACTAGAAACTTGCTC
GCGCTGCTCACACACTGGATCCCCCTACAGGCAACTATTGACGGCCTGACGCACTCCACGTCCTCCTCATCACCG
GTCACCGTAGTATGCGGAAGGAAGGGCCTTACCGGCCGGATCTTATATCAGCTCATATTTACGCTTTTTCCGGTG
GTGAATCGTGAGCCCACCCGCACCAGCTATTCGGCAAGCTGGCGTTTGCTGGATAGACAGGGACGAAGCTTTGTT
GATGAATTAACGTTTGCTTCAGGAACAGGTGAAGCAAAGGGATCTCCCAGTTGCTATTCCGTAGAATGCCATACC
GGGCGCTTTGTTGATGTCAGTGGATTAAAGTCACCTTCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail