Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4510
Gene name
Locationscaffold_358:19811..20424
Strand-
Gene length (bp)613
Transcript length (bp)552
Coding sequence length (bp)549
Protein length (aa) 183

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6438 0.4758 0.205 0.1937 0.2482 0.0281 0.078 0.0822 0.0668 0.0265

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5056
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|982
Ophiocordyceps australis map64 (Brazil) OphauB2|2800
Ophiocordyceps camponoti-floridani Ophcf2|02410
Ophiocordyceps camponoti-rufipedis Ophun1|6753
Ophiocordyceps kimflemingae Ophio5|4510 (this protein)
Ophiocordyceps subramaniannii Hirsu2|276

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4510
MSSSRSGSSSSKDSSKSNRPRSSVLQHIECLTTHRVNTLTELCRIERIAASCDDEADAKAFQKPMTNAWVYYVTT
SQQLLTELRGLSRNYPLSSDVVREAHRRVRADPNSNRSWNLAWLCLRKIKDDGLIATYAAVEAAKPEMWASTRPS
ADDVARLVACFEREWNMAVDTMLRHWQRAPAWY
Coding >Ophio5|4510
ATGTCGTCAAGCCGAAGCGGCAGTTCCAGCTCCAAAGACAGCAGCAAGTCCAACAGGCCCAGATCGTCGGTCCTA
CAGCACATCGAATGCCTAACAACGCACCGCGTCAACACGCTCACCGAGCTCTGCCGCATCGAGCGTATAGCCGCC
TCCTGCGACGACGAAGCCGACGCAAAGGCCTTCCAGAAGCCCATGACAAACGCCTGGGTCTACTACGTCACCACC
AGTCAACAGCTCCTCACCGAGCTGCGTGGCCTCTCGAGAAACTACCCCCTGAGCAGCGACGTGGTGCGCGAGGCG
CACAGAAGGGTACGCGCCGACCCCAACAGCAACCGTAGCTGGAACCTGGCCTGGCTGTGCCTGCGCAAGATCAAG
GACGACGGTCTGATAGCTACGTACGCGGCTGTCGAGGCGGCCAAGCCCGAGATGTGGGCTTCGACGAGGCCCAGT
GCCGACGATGTCGCTAGACTGGTTGCTTGCTTTGAGCGGGAGTGGAACATGGCCGTGGATACGATGCTGAGGCAT
TGGCAGCGTGCGCCGGCTTGGTAT
Transcript >Ophio5|4510
ATGTCGTCAAGCCGAAGCGGCAGTTCCAGCTCCAAAGACAGCAGCAAGTCCAACAGGCCCAGATCGTCGGTCCTA
CAGCACATCGAATGCCTAACAACGCACCGCGTCAACACGCTCACCGAGCTCTGCCGCATCGAGCGTATAGCCGCC
TCCTGCGACGACGAAGCCGACGCAAAGGCCTTCCAGAAGCCCATGACAAACGCCTGGGTCTACTACGTCACCACC
AGTCAACAGCTCCTCACCGAGCTGCGTGGCCTCTCGAGAAACTACCCCCTGAGCAGCGACGTGGTGCGCGAGGCG
CACAGAAGGGTACGCGCCGACCCCAACAGCAACCGTAGCTGGAACCTGGCCTGGCTGTGCCTGCGCAAGATCAAG
GACGACGGTCTGATAGCTACGTACGCGGCTGTCGAGGCGGCCAAGCCCGAGATGTGGGCTTCGACGAGGCCCAGT
GCCGACGATGTCGCTAGACTGGTTGCTTGCTTTGAGCGGGAGTGGAACATGGCCGTGGATACGATGCTGAGGCAT
TGGCAGCGTGCGCCGGCTTGGTATTAG
Gene >Ophio5|4510
ATGTCGTCAAGCCGAAGCGGCAGTTCCAGCTCCAAAGACAGCAGCAAGTCCAACAGGCCCAGAGTGAGTAAAGAC
GGTGCTCCCGTAAAAAAAGTGGCCAGCCCCTGACTCGCCTCTGTCTTAGTCGTCGGTCCTACAGCACATCGAATG
CCTAACAACGCACCGCGTCAACACGCTCACCGAGCTCTGCCGCATCGAGCGTATAGCCGCCTCCTGCGACGACGA
AGCCGACGCAAAGGCCTTCCAGAAGCCCATGACAAACGCCTGGGTCTACTACGTCACCACCAGTCAACAGCTCCT
CACCGAGCTGCGTGGCCTCTCGAGAAACTACCCCCTGAGCAGCGACGTGGTGCGCGAGGCGCACAGAAGGGTACG
CGCCGACCCCAACAGCAACCGTAGCTGGAACCTGGCCTGGCTGTGCCTGCGCAAGATCAAGGACGACGGTCTGAT
AGCTACGTACGCGGCTGTCGAGGCGGCCAAGCCCGAGATGTGGGCTTCGACGAGGCCCAGTGCCGACGATGTCGC
TAGACTGGTTGCTTGCTTTGAGCGGGAGTGGAACATGGCCGTGGATACGATGCTGAGGCATTGGCAGCGTGCGCC
GGCTTGGTATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail