Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4509
Gene name
Locationscaffold_358:17185..19071
Strand+
Gene length (bp)1886
Transcript length (bp)1824
Coding sequence length (bp)1821
Protein length (aa) 607

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 6.5E-28 104 545
PF00083 Sugar_tr Sugar (and other) transporter 8.4E-06 141 247

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P25351|YCR3_YEAST Uncharacterized membrane protein YCR023C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR023C PE=1 SV=2 93 555 2.0E-36
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 90 553 2.0E-26
sp|Q94BZ1|ZIFL1_ARATH Protein ZINC INDUCED FACILITATOR-LIKE 1 OS=Arabidopsis thaliana GN=ZIFL1 PE=2 SV=1 68 555 9.0E-20
sp|Q8RWN2|ZIF1_ARATH Protein ZINC INDUCED FACILITATOR 1 OS=Arabidopsis thaliana GN=ZIF1 PE=1 SV=2 90 555 8.0E-19
sp|P02980|TCR2_ECOLX Tetracycline resistance protein, class B OS=Escherichia coli GN=tetA PE=1 SV=1 109 316 3.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P25351|YCR3_YEAST Uncharacterized membrane protein YCR023C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR023C PE=1 SV=2 93 555 2.0E-36
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 90 553 2.0E-26
sp|Q94BZ1|ZIFL1_ARATH Protein ZINC INDUCED FACILITATOR-LIKE 1 OS=Arabidopsis thaliana GN=ZIFL1 PE=2 SV=1 68 555 9.0E-20
sp|Q8RWN2|ZIF1_ARATH Protein ZINC INDUCED FACILITATOR 1 OS=Arabidopsis thaliana GN=ZIF1 PE=1 SV=2 90 555 8.0E-19
sp|P02980|TCR2_ECOLX Tetracycline resistance protein, class B OS=Escherichia coli GN=tetA PE=1 SV=1 109 316 3.0E-12
sp|P51563|TCR7_VIBAN Tetracycline resistance protein, class G OS=Vibrio anguillarum GN=tetA PE=3 SV=1 113 287 1.0E-08
sp|P33733|TCR4_SALOR Tetracycline resistance protein, class D OS=Salmonella ordonez GN=tetA PE=3 SV=1 109 292 3.0E-08
sp|P02982|TCR1_ECOLX Tetracycline resistance protein, class A OS=Escherichia coli GN=tetA PE=3 SV=2 99 254 1.0E-07
sp|P02981|TCR3_ECOLX Tetracycline resistance protein, class C OS=Escherichia coli GN=tetA PE=1 SV=1 113 267 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 141 163 22
2 173 190 17
3 197 219 22
4 234 256 22
5 263 285 22
6 385 407 22
7 420 442 22
8 452 474 22
9 494 516 22
10 536 558 22
11 565 584 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4509
MARAECGPRRPSAGAASRTLSSGSFHAGAPIPTLAGFRRASMHRYQTFPASMAPPAETPARDGHGHGHDDADAAS
GSCSGSSSGASSPPQSPHQQTPLPIRQLLLLAFLSLAEQTALNSISPYLPRMVASMPGVPTGQIGLYVGILASAF
ALAQLSTNFLWGYASDVVGRKPVLLAGTLSLVGCFALFGLCQRYWHVVVVHVAMGLLNGNAACVPTVLGEVTDRS
NQSKAFTYLPVIYSLGGITGPALGGLLVGRLAPSRPYLAPNVCAAALLAVSVVVVALWFQETLDDNDAGPWEPRF
LHRVSSWLRSKFRTGPGTNSWSSRWPHAQTTNQRRPLLSPESSPSSCSSSADGDDNEDGVSCQAKDAAQAKGPAW
RDLLNHKTLLLLSTYLVFQLSNISFNSLYPIFAAAPPPTGRELAPGNIGLSLSFAGLATILFQAFLYQPLKANTG
SLGAYRLSLLGIAISMVLMPWVGYLDDEPLLGIGNGRLWLYAQLGGVLVLKNICAVGGLSSIMLLITNSAPSHAS
LGTLNGVAQTLSALGRSFGPFVSGGLFSLSINVRPNGEALAWSVFGGLALAGWVGSLFIRGDGLESEDWDGDEES
EDDYGQA
Coding >Ophio5|4509
ATGGCCCGCGCCGAGTGCGGCCCGCGGCGGCCTAGCGCCGGTGCCGCGAGCCGTACGCTATCGTCTGGCTCGTTT
CATGCCGGCGCGCCTATTCCTACACTGGCGGGCTTCCGTCGCGCCTCGATGCATCGCTACCAGACCTTTCCAGCG
AGCATGGCACCGCCAGCCGAGACGCCCGCCAGAGATGGCCATGGCCATGGCCATGACGATGCCGATGCCGCCTCT
GGCTCTTGCTCCGGCTCTTCCTCTGGAGCATCGTCGCCGCCTCAGTCGCCGCATCAGCAGACGCCTCTGCCGATC
CGCCAGCTGCTCCTCCTGGCCTTTCTCTCCCTCGCCGAGCAGACGGCGCTCAATTCTATATCGCCTTACCTTCCT
CGCATGGTTGCCTCGATGCCCGGTGTTCCCACGGGCCAGATCGGGCTCTACGTCGGCATCCTCGCCAGCGCCTTC
GCATTGGCCCAGCTCTCGACCAACTTCCTCTGGGGATATGCCTCGGATGTCGTCGGCCGCAAGCCTGTGTTGCTG
GCCGGTACCCTGTCGCTGGTCGGATGCTTCGCGCTCTTCGGCCTGTGTCAACGCTATTGGCACGTCGTCGTCGTC
CACGTCGCCATGGGCCTGCTCAATGGCAACGCTGCCTGCGTGCCCACTGTCCTTGGCGAGGTGACGGACCGTTCG
AACCAGAGCAAAGCATTTACTTACCTACCCGTCATCTACTCGCTCGGCGGTATCACTGGTCCGGCCCTCGGCGGC
CTGCTCGTAGGCCGTCTCGCGCCGTCTCGCCCCTATTTGGCCCCCAACGTCTGCGCCGCCGCCCTGCTGGCCGTC
AGCGTCGTCGTTGTCGCCCTTTGGTTTCAGGAGACGCTCGATGACAATGATGCGGGGCCTTGGGAGCCCCGATTC
CTTCATCGTGTCTCTTCGTGGCTGCGGTCCAAGTTCCGGACCGGACCGGGCACTAACTCGTGGAGCTCGCGCTGG
CCGCACGCTCAGACGACGAATCAGCGCCGGCCCCTGCTGTCCCCCGAATCGTCTCCCTCCTCCTGCTCCTCCTCC
GCCGATGGCGACGATAATGAAGATGGCGTGTCATGCCAGGCCAAGGACGCCGCTCAAGCCAAGGGACCCGCCTGG
CGGGATCTCCTGAACCACAAGACCCTCCTTCTCCTCTCCACCTACCTCGTCTTCCAGCTGTCCAACATCAGCTTC
AACAGCCTGTACCCCATCTTTGCCGCCGCCCCTCCCCCGACGGGCCGCGAGCTGGCCCCGGGCAACATTGGCCTC
AGTCTCAGCTTCGCCGGCCTGGCCACCATCCTCTTTCAGGCCTTTCTTTACCAGCCGCTCAAGGCCAACACCGGC
AGCCTAGGGGCATACCGCCTGTCCCTGCTCGGCATCGCCATCAGCATGGTGCTCATGCCCTGGGTCGGCTATCTC
GACGACGAGCCGCTACTGGGCATCGGCAACGGCCGTCTATGGCTCTACGCACAACTAGGCGGTGTCCTCGTCCTC
AAAAACATCTGCGCCGTCGGCGGCCTGTCGAGCATAATGCTTCTGATTACCAACTCGGCTCCGTCACACGCCAGC
CTCGGCACGCTCAACGGCGTGGCCCAGACGCTCTCGGCCCTGGGGCGCAGTTTCGGGCCCTTTGTCTCCGGAGGC
CTCTTCTCCCTGTCCATCAACGTCCGCCCCAACGGCGAAGCCCTGGCATGGAGCGTCTTTGGAGGTCTCGCCTTG
GCTGGATGGGTCGGATCGCTATTCATCCGAGGCGACGGCCTGGAGAGCGAAGATTGGGACGGTGACGAGGAGTCC
GAAGACGACTACGGCCAAGCC
Transcript >Ophio5|4509
ATGGCCCGCGCCGAGTGCGGCCCGCGGCGGCCTAGCGCCGGTGCCGCGAGCCGTACGCTATCGTCTGGCTCGTTT
CATGCCGGCGCGCCTATTCCTACACTGGCGGGCTTCCGTCGCGCCTCGATGCATCGCTACCAGACCTTTCCAGCG
AGCATGGCACCGCCAGCCGAGACGCCCGCCAGAGATGGCCATGGCCATGGCCATGACGATGCCGATGCCGCCTCT
GGCTCTTGCTCCGGCTCTTCCTCTGGAGCATCGTCGCCGCCTCAGTCGCCGCATCAGCAGACGCCTCTGCCGATC
CGCCAGCTGCTCCTCCTGGCCTTTCTCTCCCTCGCCGAGCAGACGGCGCTCAATTCTATATCGCCTTACCTTCCT
CGCATGGTTGCCTCGATGCCCGGTGTTCCCACGGGCCAGATCGGGCTCTACGTCGGCATCCTCGCCAGCGCCTTC
GCATTGGCCCAGCTCTCGACCAACTTCCTCTGGGGATATGCCTCGGATGTCGTCGGCCGCAAGCCTGTGTTGCTG
GCCGGTACCCTGTCGCTGGTCGGATGCTTCGCGCTCTTCGGCCTGTGTCAACGCTATTGGCACGTCGTCGTCGTC
CACGTCGCCATGGGCCTGCTCAATGGCAACGCTGCCTGCGTGCCCACTGTCCTTGGCGAGGTGACGGACCGTTCG
AACCAGAGCAAAGCATTTACTTACCTACCCGTCATCTACTCGCTCGGCGGTATCACTGGTCCGGCCCTCGGCGGC
CTGCTCGTAGGCCGTCTCGCGCCGTCTCGCCCCTATTTGGCCCCCAACGTCTGCGCCGCCGCCCTGCTGGCCGTC
AGCGTCGTCGTTGTCGCCCTTTGGTTTCAGGAGACGCTCGATGACAATGATGCGGGGCCTTGGGAGCCCCGATTC
CTTCATCGTGTCTCTTCGTGGCTGCGGTCCAAGTTCCGGACCGGACCGGGCACTAACTCGTGGAGCTCGCGCTGG
CCGCACGCTCAGACGACGAATCAGCGCCGGCCCCTGCTGTCCCCCGAATCGTCTCCCTCCTCCTGCTCCTCCTCC
GCCGATGGCGACGATAATGAAGATGGCGTGTCATGCCAGGCCAAGGACGCCGCTCAAGCCAAGGGACCCGCCTGG
CGGGATCTCCTGAACCACAAGACCCTCCTTCTCCTCTCCACCTACCTCGTCTTCCAGCTGTCCAACATCAGCTTC
AACAGCCTGTACCCCATCTTTGCCGCCGCCCCTCCCCCGACGGGCCGCGAGCTGGCCCCGGGCAACATTGGCCTC
AGTCTCAGCTTCGCCGGCCTGGCCACCATCCTCTTTCAGGCCTTTCTTTACCAGCCGCTCAAGGCCAACACCGGC
AGCCTAGGGGCATACCGCCTGTCCCTGCTCGGCATCGCCATCAGCATGGTGCTCATGCCCTGGGTCGGCTATCTC
GACGACGAGCCGCTACTGGGCATCGGCAACGGCCGTCTATGGCTCTACGCACAACTAGGCGGTGTCCTCGTCCTC
AAAAACATCTGCGCCGTCGGCGGCCTGTCGAGCATAATGCTTCTGATTACCAACTCGGCTCCGTCACACGCCAGC
CTCGGCACGCTCAACGGCGTGGCCCAGACGCTCTCGGCCCTGGGGCGCAGTTTCGGGCCCTTTGTCTCCGGAGGC
CTCTTCTCCCTGTCCATCAACGTCCGCCCCAACGGCGAAGCCCTGGCATGGAGCGTCTTTGGAGGTCTCGCCTTG
GCTGGATGGGTCGGATCGCTATTCATCCGAGGCGACGGCCTGGAGAGCGAAGATTGGGACGGTGACGAGGAGTCC
GAAGACGACTACGGCCAAGCCTGA
Gene >Ophio5|4509
ATGGCCCGCGCCGAGTGCGGCCCGCGGCGGCCTAGCGCCGGTGCCGCGAGCCGTACGCTATCGTCTGGCTCGTTT
CATGCCGGCGCGCCTATTCCTACACTGGCGGGCTTCCGTCGCGCCTCGATGCATCGCTACCAGACCTTTCCAGCG
AGCATGGCACCGCCAGCCGAGACGCCCGCCAGAGATGGCCATGGCCATGGCCATGACGATGCCGATGCCGCCTCT
GGCTCTTGCTCCGGCTCTTCCTCTGGAGCATCGTCGCCGCCTCAGTCGCCGCATCAGCAGACGCCTCTGCCGATC
CGCCAGCTGCTCCTCCTGGCCTTTCTCTCCCTCGCCGAGCAGACGGCGCTCAATTCTATATCGCCTTACCTTCCT
CGCATGGTTGCCTCGATGCCCGGTGTTCCCACGGGCCAGATCGGGCTCTACGTCGGCATCCTCGCCAGCGCCTTC
GCATTGGCCCAGCTCTCGACCAACTTCCTCTGGGGATATGCCTCGGATGTCGTCGGCCGCAAGCCTGTGTTGCTG
GCCGGTACCCTGTCGCTGGTCGGATGCTTCGCGCTCTTCGGCCTGTGTCAACGCTATTGGCACGTCGTCGTCGTC
CACGTCGCCATGGGCCTGCTCAATGGCAACGCTGCCTGCGTGCCCACTGTCCTTGGCGAGGTGACGGACCGTTCG
AACCAGAGCAAAGCATTTACTTACCTACCCGTCATCTACTCGCTCGGCGGTATCACTGGTCCGGCCCTCGGCGGC
CTGCTCGTAGGCCGTCTCGCGCCGTCTCGCCCCTATTTGGCCCCCAACGTCTGCGCCGCCGCCCTGCTGGCCGTC
AGCGTCGTCGTTGTCGCCCTTTGGTTTCAGGAGACGCTCGATGACAATGATGCGGGGCCTTGGGAGCCCCGATTC
CTTCATCGTGTCTCTTCGTGGCTGCGGTCCAAGTTCCGGACCGGACCGGGCACTAACTCGTGGAGCTCGCGCTGG
CCGCACGCTCAGACGACGAATCAGCGCCGGCCCCTGCTGTCCCCCGAATCGTCTCCCTCCTCCTGCTCCTCCTCC
GCCGATGGCGACGATAATGAAGATGGCGTGTCATGCCAGGCCAAGGACGCCGCTCAAGCCAAGGGACCCGCCTGG
CGGGATCTCCTGAACCACAAGACCCTCCTTCTCCTCTCCACCTACCTCGTCTTCCAGCTGTCCAACATCAGCTTC
AACAGCCTGTACCCCATCTTTGCCGCCGCCCCTCCCCCGACGGGCCGCGAGCTGGCCCCGGGCAACATTGGCCTC
AGTCTCAGCTTCGCCGGCCTGGCCACCATCCTCTTTCAGGCCTTTCTTTACCAGCCGCTCAAGGCCAACACCGGC
AGCCTAGGGGCATACCGCCTGTCCCTGCTCGGCATCGCCATCAGCATGGTGCTCATGCCCTGGGTCGGCTATCTC
GACGACGAGCCGCTACTGGGCATCGGCAACGGCCGTCTATGGCTCTACGCACAACTAGGCGGTGTCCTCGTCCTC
AAAAACATCTGCGCCGTCGGCGGCCTGTCGAGCATAATGCTTCTGGTATGGCTCGCTTCCCTCTTCACTACCTTG
TGCGGAATGCGTGACTGACTCGCCGGCGTTAGATTACCAACTCGGCTCCGTCACACGCCAGCCTCGGCACGCTCA
ACGGCGTGGCCCAGACGCTCTCGGCCCTGGGGCGCAGTTTCGGGCCCTTTGTCTCCGGAGGCCTCTTCTCCCTGT
CCATCAACGTCCGCCCCAACGGCGAAGCCCTGGCATGGAGCGTCTTTGGAGGTCTCGCCTTGGCTGGATGGGTCG
GATCGCTATTCATCCGAGGCGACGGCCTGGAGAGCGAAGATTGGGACGGTGACGAGGAGTCCGAAGACGACTACG
GCCAAGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail