Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4506
Gene name
Locationscaffold_358:6639..9005
Strand+
Gene length (bp)2366
Transcript length (bp)2253
Coding sequence length (bp)2250
Protein length (aa) 750

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13641 Glyco_tranf_2_3 Glycosyltransferase like family 2 5.1E-17 229 462
PF13632 Glyco_trans_2_3 Glycosyl transferase family group 2 2.8E-17 329 512
PF03552 Cellulose_synt Cellulose synthase 1.7E-11 386 539
PF00535 Glycos_transf_2 Glycosyl transferase family 2 6.1E-11 231 409
PF13506 Glyco_transf_21 Glycosyl transferase family 21 1.0E-10 326 461

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9RBJ2|BCSA4_KOMXY Putative cellulose synthase 2 OS=Komagataeibacter xylinus GN=bcsABII-A PE=3 SV=1 214 523 4.0E-30
sp|Q9WX75|BCSA5_KOMXY Putative cellulose synthase 3 OS=Komagataeibacter xylinus GN=bcsABII-B PE=3 SV=1 214 523 4.0E-30
sp|P19449|BCSA1_KOMXY Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus GN=bcsA PE=1 SV=1 228 648 9.0E-30
sp|O82859|BCSA2_KOMXY Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus GN=bcsA PE=3 SV=1 228 521 3.0E-29
sp|Q8Z291|BCSA_SALTI Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhi GN=bcsA PE=3 SV=1 153 512 7.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9RBJ2|BCSA4_KOMXY Putative cellulose synthase 2 OS=Komagataeibacter xylinus GN=bcsABII-A PE=3 SV=1 214 523 4.0E-30
sp|Q9WX75|BCSA5_KOMXY Putative cellulose synthase 3 OS=Komagataeibacter xylinus GN=bcsABII-B PE=3 SV=1 214 523 4.0E-30
sp|P19449|BCSA1_KOMXY Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus GN=bcsA PE=1 SV=1 228 648 9.0E-30
sp|O82859|BCSA2_KOMXY Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus GN=bcsA PE=3 SV=1 228 521 3.0E-29
sp|Q8Z291|BCSA_SALTI Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhi GN=bcsA PE=3 SV=1 153 512 7.0E-29
sp|Q59167|ACSA2_KOMHA Cellulose synthase 2 OS=Komagataeibacter hansenii GN=acsAII PE=3 SV=1 215 523 1.0E-28
sp|Q93IN2|BCSA_SALTY Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=bcsA PE=3 SV=1 153 512 2.0E-28
sp|P0CW87|ACSA1_KOMXY Cellulose synthase 1 OS=Komagataeibacter xylinus GN=acsAB PE=1 SV=1 226 521 2.0E-28
sp|P58931|BCSA_PSEFS Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) GN=bcsA PE=3 SV=2 154 524 2.0E-28
sp|Q76KJ8|ACSA1_KOMHA Cellulose synthase 1 OS=Komagataeibacter hansenii GN=acsAB PE=1 SV=1 226 521 3.0E-28
sp|Q9WX61|BCSA3_KOMXY Cellulose synthase 1 catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus GN=bcsAI PE=3 SV=1 226 580 5.0E-28
sp|P37653|BCSA_ECOLI Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli (strain K12) GN=bcsA PE=1 SV=3 228 512 1.0E-26
sp|Q8X5L7|BCSA_ECO57 Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli O157:H7 GN=bcsA PE=3 SV=2 228 512 2.0E-26
sp|P58932|BCSA_XANAC Cellulose synthase catalytic subunit [UDP-forming] OS=Xanthomonas axonopodis pv. citri (strain 306) GN=bcsA PE=3 SV=1 228 500 5.0E-23
sp|Q9U720|DCSA_DICDI Cellulose synthase catalytic subunit A [UDP-forming] OS=Dictyostelium discoideum GN=dcsA PE=1 SV=1 290 466 4.0E-18
sp|Q9SJA2|CSLC8_ARATH Probable xyloglucan glycosyltransferase 8 OS=Arabidopsis thaliana GN=CSLC8 PE=2 SV=1 224 463 1.0E-16
sp|Q9SB75|CSLC5_ARATH Probable xyloglucan glycosyltransferase 5 OS=Arabidopsis thaliana GN=CSLC5 PE=1 SV=1 224 463 5.0E-16
sp|Q7PC70|CSLC2_ORYSI Probable xyloglucan glycosyltransferase 2 OS=Oryza sativa subsp. indica GN=CSLC2 PE=2 SV=1 214 463 2.0E-15
sp|Q69L19|CSLC2_ORYSJ Probable xyloglucan glycosyltransferase 2 OS=Oryza sativa subsp. japonica GN=CSLC2 PE=2 SV=2 216 463 3.0E-15
sp|Q6YWK8|CSLAB_ORYSJ Probable mannan synthase 11 OS=Oryza sativa subsp. japonica GN=CSLA11 PE=2 SV=1 247 513 6.0E-14
sp|Q7XIF5|CSLA7_ORYSJ Probable mannan synthase 7 OS=Oryza sativa subsp. japonica GN=CSLA7 PE=2 SV=1 226 471 7.0E-14
sp|Q9SRT3|CSLC6_ARATH Probable xyloglucan glycosyltransferase 6 OS=Arabidopsis thaliana GN=CSLC6 PE=1 SV=1 220 473 4.0E-13
sp|Q7PC73|CSLA5_ORYSJ Probable mannan synthase 5 OS=Oryza sativa subsp. japonica GN=CSLA5 PE=2 SV=1 247 471 5.0E-13
sp|Q67X45|CSLA3_ORYSJ Probable mannan synthase 3 OS=Oryza sativa subsp. japonica GN=CSLA3 PE=2 SV=1 247 466 1.0E-12
sp|Q9LZR3|CSLA9_ARATH Glucomannan 4-beta-mannosyltransferase 9 OS=Arabidopsis thaliana GN=CSLA9 PE=2 SV=1 247 473 1.0E-12
sp|Q8LIY0|CSLC1_ORYSJ Probable xyloglucan glycosyltransferase 1 OS=Oryza sativa subsp. japonica GN=CSLC1 PE=3 SV=1 226 473 1.0E-12
sp|Q6Z2T9|CSLA6_ORYSJ Probable mannan synthase 6 OS=Oryza sativa subsp. japonica GN=CSLA6 PE=2 SV=2 247 463 2.0E-12
sp|Q7PC69|CSLC3_ORYSJ Probable xyloglucan glycosyltransferase 3 OS=Oryza sativa subsp. japonica GN=CSLC3 PE=2 SV=1 224 509 2.0E-12
sp|Q6AU53|CSLC9_ORYSJ Probable xyloglucan glycosyltransferase 9 OS=Oryza sativa subsp. japonica GN=CSLC9 PE=2 SV=2 228 463 2.0E-12
sp|Q9LJP4|CSLC4_ARATH Xyloglucan glycosyltransferase 4 OS=Arabidopsis thaliana GN=CSLC4 PE=1 SV=1 228 463 2.0E-12
sp|Q6UDF0|CSLA1_CYATE Mannan synthase 1 OS=Cyamopsis tetragonoloba GN=ManS PE=1 SV=1 195 463 4.0E-12
sp|Q8S7W0|CSLA4_ORYSJ Probable mannan synthase 4 OS=Oryza sativa subsp. japonica GN=CSLA4 PE=2 SV=1 247 471 6.0E-12
sp|Q7PC67|CSLA2_ORYSJ Probable mannan synthase 2 OS=Oryza sativa subsp. japonica GN=CSLA2 PE=2 SV=2 247 471 1.0E-11
sp|Q9FNI7|CSLA2_ARATH Glucomannan 4-beta-mannosyltransferase 2 OS=Arabidopsis thaliana GN=CSLA2 PE=2 SV=1 247 463 2.0E-11
sp|Q9ZQB9|CSLCC_ARATH Probable xyloglucan glycosyltransferase 12 OS=Arabidopsis thaliana GN=CSLC12 PE=1 SV=1 224 463 3.0E-11
sp|Q6L538|CSLC7_ORYSJ Probable xyloglucan glycosyltransferase 7 OS=Oryza sativa subsp. japonica GN=CSLC7 PE=2 SV=1 226 473 3.0E-11
sp|Q84Z01|CSLCA_ORYSJ Putative xyloglucan glycosyltransferase 10 OS=Oryza sativa subsp. japonica GN=CSLC10 PE=3 SV=1 224 463 1.0E-10
sp|A2YHR9|CSLCA_ORYSI Putative xyloglucan glycosyltransferase 10 OS=Oryza sativa subsp. indica GN=CSLC10 PE=3 SV=1 224 463 1.0E-10
sp|Q7PC76|CSLA1_ORYSJ Glucomannan 4-beta-mannosyltransferase 1 OS=Oryza sativa subsp. japonica GN=CSLA1 PE=3 SV=1 247 463 2.0E-10
sp|Q9T0L2|CSLAF_ARATH Probable mannan synthase 15 OS=Arabidopsis thaliana GN=CSLA15 PE=3 SV=2 228 463 4.0E-10
sp|Q9LQC9|CSLA3_ARATH Probable mannan synthase 3 OS=Arabidopsis thaliana GN=CSLA3 PE=2 SV=1 220 532 4.0E-10
sp|Q8NUI7|ICAA_STAAW Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MW2) GN=icaA PE=3 SV=1 200 463 1.0E-09
sp|Q6G608|ICAA_STAAS Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MSSA476) GN=icaA PE=3 SV=1 200 463 1.0E-09
sp|Q9LF09|CSLAB_ARATH Probable mannan synthase 11 OS=Arabidopsis thaliana GN=CSLA11 PE=2 SV=2 220 463 2.0E-09
sp|Q8GLC5|ICAA_STAEP Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis GN=icaA PE=3 SV=1 233 463 3.0E-09
sp|Q99QX3|ICAA_STAAM Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=icaA PE=3 SV=1 200 463 4.0E-09
sp|Q9RQP9|ICAA_STAA8 Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain NCTC 8325) GN=icaA PE=3 SV=2 200 463 4.0E-09
sp|Q5HCN1|ICAA_STAAC Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) GN=icaA PE=3 SV=1 200 463 4.0E-09
sp|Q7A351|ICAA_STAAN Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain N315) GN=icaA PE=3 SV=1 200 463 4.0E-09
sp|Q6GDD8|ICAA_STAAR Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) GN=icaA PE=3 SV=1 200 463 4.0E-09
sp|Q5HKQ0|ICAA_STAEQ Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=icaA PE=1 SV=1 233 463 5.0E-09
sp|Q67VS7|CSLA9_ORYSJ Probable mannan synthase 9 OS=Oryza sativa subsp. japonica GN=CSLA9 PE=2 SV=1 247 471 6.0E-09
sp|Q8XAR5|PGAC_ECO57 Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli O157:H7 GN=pgaC PE=3 SV=1 228 483 2.0E-08
sp|P75905|PGAC_ECOLI Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli (strain K12) GN=pgaC PE=1 SV=1 228 483 2.0E-08
sp|Q9ZQN8|CSLA7_ARATH Probable mannan synthase 7 OS=Arabidopsis thaliana GN=CSLA7 PE=2 SV=2 240 463 2.0E-08
sp|Q84W06|CSLAE_ARATH Probable mannan synthase 14 OS=Arabidopsis thaliana GN=CSLA14 PE=2 SV=2 247 463 4.0E-08
sp|Q84W54|CSLA1_ARATH Probable mannan synthase 1 OS=Arabidopsis thaliana GN=CSLA1 PE=2 SV=1 228 509 1.0E-07
sp|Q84ZN6|CESA8_ORYSJ Probable cellulose synthase A catalytic subunit 8 [UDP-forming] OS=Oryza sativa subsp. japonica GN=CESA8 PE=2 SV=1 385 536 1.0E-07
sp|Q3MB01|BMGDS_ANAVT Beta-monoglucosyldiacylglycerol synthase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=Ava_2217 PE=1 SV=1 214 463 2.0E-07
sp|Q84M43|CESA2_ORYSJ Probable cellulose synthase A catalytic subunit 2 [UDP-forming] OS=Oryza sativa subsp. japonica GN=CESA2 PE=2 SV=1 385 536 2.0E-07
sp|A2XN66|CESA2_ORYSI Probable cellulose synthase A catalytic subunit 2 [UDP-forming] OS=Oryza sativa subsp. indica GN=CESA2 PE=3 SV=1 385 536 2.0E-07
sp|Q84JA6|CESA4_ARATH Cellulose synthase A catalytic subunit 4 [UDP-forming] OS=Arabidopsis thaliana GN=CESA4 PE=1 SV=1 385 522 5.0E-06
sp|Q6YVM4|CESA6_ORYSJ Probable cellulose synthase A catalytic subunit 6 [UDP-forming] OS=Oryza sativa subsp. japonica GN=CESA6 PE=2 SV=1 385 536 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016760 cellulose synthase (UDP-forming) activity Yes
GO:0030244 cellulose biosynthetic process Yes
GO:0016020 membrane Yes
GO:0016757 glycosyltransferase activity Yes
GO:0005975 carbohydrate metabolic process No
GO:0030243 cellulose metabolic process No
GO:0016740 transferase activity No
GO:0016758 hexosyltransferase activity No
GO:0044260 cellular macromolecule metabolic process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0046527 glucosyltransferase activity No
GO:0044262 cellular carbohydrate metabolic process No
GO:0034637 cellular carbohydrate biosynthetic process No
GO:0016759 cellulose synthase activity No
GO:0008150 biological_process No
GO:0043170 macromolecule metabolic process No
GO:0008194 UDP-glycosyltransferase activity No
GO:0033692 cellular polysaccharide biosynthetic process No
GO:0005976 polysaccharide metabolic process No
GO:0009058 biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0044264 cellular polysaccharide metabolic process No
GO:0051273 beta-glucan metabolic process No
GO:0003824 catalytic activity No
GO:0044042 glucan metabolic process No
GO:0051274 beta-glucan biosynthetic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0016051 carbohydrate biosynthetic process No
GO:0005575 cellular_component No
GO:0009059 macromolecule biosynthetic process No
GO:0035251 UDP-glucosyltransferase activity No
GO:0006073 cellular glucan metabolic process No
GO:0000271 polysaccharide biosynthetic process No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0009250 glucan biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 153 175 22
2 185 207 22
3 492 514 22
4 568 590 22
5 623 645 22
6 668 690 22
7 726 748 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 0.12 0.00 0.36
CcL In ants, during behavior modification 276.08 104.34 447.81
CcD In ants, recently dead 152.89 69.86 235.92

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.023151 yes
SC16a CcD 0.023151 yes
CcL CcD 0.037477 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4506
MADTPDLERQPMPSPLQDTPLDLRLTLGDAAPAPLQLHDEKNWSPPSATGKSDSHTLVNNRQSGGSISSWQTGQQ
TPVSSATAISKFSAFNSYPSTPMNQSNISLAALLHNSLPQPVSKEFAETADSIAVVGDRDDTDTWRGWRRHLFRL
VPLLILLNSIIYVLYLVYRILCIIWSQWRHNETYVAAWIFIGVEIAVAIPSLMHNSWTMWSMKRRRRLKLRLKGY
EVPTVDVFITCCGEDDDLVLDTVRAACDLDYPDDRYRVIVLDDGKSAGLEGSVIRMTGNYANLYYMAREKIPGKP
HHFKAGNLNYGLDLVHRLPGGAGQFMAALDADMIPERDWLRAILPHLLVDPKMALACPPQLFYNTPPSDPLAQSL
DFFVHVIEPIKDALGVAWCTGSGYVARREALDDIGNFPLGSLAEDVATSTHMLGKGWKTAYVHEPLQFGTVPEDY
GSHLKQRTRWAIGTVDTSFKLNFCLWGEQVRQMTFAQRFSGFLYATLSLYTIALTVSLFAIPIILLMGKTLVAYA
TEEQLRWLIRMCFAATISNRLCEFVLSVPAGYHTGQRSARYQLWMAPYIALCIVRSFVLPTWLGGTAQAFKPTGS
LSSALNERDPLRKKNMIRRLWAILFNYMGFFHLAFVYMTLAGVAMTSFRCFVTATNLKDMLLSLVTHAFWPPLTF
IFICSSLWVPIAYAIDPPMMPDREELLARDPKTQVAHPTPRSKKIAFGGQAAWFELELTTSTLFTALIFTLSFLF
Coding >Ophio5|4506
ATGGCCGACACGCCCGACCTGGAGCGTCAACCCATGCCGTCGCCTCTTCAAGACACCCCTCTGGACCTGCGCCTG
ACCCTTGGCGATGCCGCGCCCGCTCCCCTGCAGCTCCACGATGAAAAGAACTGGTCTCCTCCATCTGCTACCGGC
AAGTCGGATTCACACACGCTCGTCAATAACCGTCAATCCGGCGGCAGCATCAGCTCCTGGCAGACGGGCCAGCAG
ACGCCCGTCAGCTCGGCCACGGCCATTAGCAAGTTCTCCGCCTTCAACTCCTACCCCTCGACTCCCATGAATCAG
AGCAACATCAGCCTCGCCGCTCTGCTACATAATTCTCTCCCACAGCCAGTCAGCAAAGAGTTCGCTGAGACTGCC
GACTCGATTGCCGTCGTGGGCGATCGAGACGACACCGACACCTGGCGTGGCTGGAGGCGTCACCTCTTCCGCCTC
GTTCCCCTGCTCATCCTCCTCAATTCCATCATCTACGTCCTGTACCTGGTTTACCGTATACTCTGTATCATTTGG
TCTCAATGGCGGCACAACGAAACATATGTGGCCGCTTGGATTTTTATCGGCGTCGAGATCGCCGTTGCCATTCCT
TCACTCATGCACAATTCCTGGACAATGTGGTCCATGAAGAGACGGAGACGGCTCAAGCTGAGGCTCAAGGGCTAC
GAGGTTCCTACCGTCGACGTCTTCATCACCTGCTGCGGCGAGGACGACGATCTCGTCCTCGACACCGTCCGCGCC
GCTTGCGACCTGGATTACCCCGATGATCGGTACAGGGTCATTGTGCTCGACGACGGCAAGTCGGCCGGCCTCGAG
GGCTCCGTCATCCGCATGACGGGCAACTACGCCAACCTGTATTACATGGCCCGCGAAAAGATACCCGGCAAGCCG
CACCACTTCAAGGCCGGCAATCTCAACTACGGACTGGACCTGGTCCACCGTCTCCCCGGCGGGGCTGGCCAATTC
ATGGCTGCCCTCGACGCCGACATGATTCCGGAGAGAGACTGGCTTCGCGCCATACTGCCTCACCTCCTCGTCGAC
CCCAAGATGGCTCTGGCGTGTCCCCCGCAACTGTTTTACAACACGCCCCCCTCTGATCCTCTCGCCCAGAGTCTC
GACTTCTTCGTCCACGTCATCGAGCCCATCAAGGACGCGCTCGGCGTTGCCTGGTGCACAGGCTCTGGCTACGTC
GCTCGTCGCGAGGCCCTCGACGACATTGGCAACTTTCCGCTGGGCTCTCTCGCCGAAGACGTCGCCACCTCGACG
CACATGCTGGGCAAGGGCTGGAAGACGGCCTACGTGCACGAGCCGCTGCAGTTTGGCACCGTGCCGGAGGACTAC
GGGAGCCACCTCAAACAGAGGACGCGCTGGGCGATTGGCACCGTCGACACGTCCTTCAAGCTCAACTTCTGCCTG
TGGGGTGAGCAGGTCCGGCAGATGACGTTTGCCCAGCGCTTCTCCGGCTTCCTCTACGCCACGCTCAGTCTGTAC
ACCATCGCCCTGACCGTCTCGCTCTTCGCCATCCCCATCATCCTCCTCATGGGCAAGACGCTGGTGGCCTATGCC
ACCGAGGAGCAGCTGCGGTGGCTGATCCGCATGTGCTTCGCCGCCACCATCTCCAACCGACTCTGCGAGTTCGTC
CTCTCCGTTCCCGCCGGCTACCACACGGGCCAGAGGAGCGCCCGTTACCAGTTGTGGATGGCGCCCTACATCGCC
CTCTGCATCGTCCGGTCTTTCGTCCTGCCGACCTGGCTCGGCGGCACGGCCCAGGCCTTTAAGCCGACCGGGTCC
CTCTCCTCGGCGCTCAACGAACGCGACCCGCTCCGCAAGAAGAATATGATCCGGCGGTTGTGGGCCATCCTGTTC
AACTACATGGGATTCTTCCACCTGGCCTTTGTCTACATGACGCTTGCGGGCGTGGCCATGACGTCGTTCCGCTGC
TTCGTCACGGCCACCAACCTCAAGGACATGCTGCTCTCGCTCGTGACGCACGCCTTCTGGCCGCCACTGACGTTC
ATCTTCATCTGCAGCTCGCTCTGGGTGCCGATAGCGTACGCCATTGACCCGCCCATGATGCCGGACCGCGAGGAG
CTGCTGGCGAGGGACCCCAAGACGCAGGTGGCGCATCCGACGCCGCGGAGCAAGAAGATTGCCTTTGGCGGGCAG
GCGGCCTGGTTCGAGCTCGAGCTGACGACGTCGACGCTCTTTACCGCCCTCATCTTTACCCTCTCGTTTTTGTTT
Transcript >Ophio5|4506
ATGGCCGACACGCCCGACCTGGAGCGTCAACCCATGCCGTCGCCTCTTCAAGACACCCCTCTGGACCTGCGCCTG
ACCCTTGGCGATGCCGCGCCCGCTCCCCTGCAGCTCCACGATGAAAAGAACTGGTCTCCTCCATCTGCTACCGGC
AAGTCGGATTCACACACGCTCGTCAATAACCGTCAATCCGGCGGCAGCATCAGCTCCTGGCAGACGGGCCAGCAG
ACGCCCGTCAGCTCGGCCACGGCCATTAGCAAGTTCTCCGCCTTCAACTCCTACCCCTCGACTCCCATGAATCAG
AGCAACATCAGCCTCGCCGCTCTGCTACATAATTCTCTCCCACAGCCAGTCAGCAAAGAGTTCGCTGAGACTGCC
GACTCGATTGCCGTCGTGGGCGATCGAGACGACACCGACACCTGGCGTGGCTGGAGGCGTCACCTCTTCCGCCTC
GTTCCCCTGCTCATCCTCCTCAATTCCATCATCTACGTCCTGTACCTGGTTTACCGTATACTCTGTATCATTTGG
TCTCAATGGCGGCACAACGAAACATATGTGGCCGCTTGGATTTTTATCGGCGTCGAGATCGCCGTTGCCATTCCT
TCACTCATGCACAATTCCTGGACAATGTGGTCCATGAAGAGACGGAGACGGCTCAAGCTGAGGCTCAAGGGCTAC
GAGGTTCCTACCGTCGACGTCTTCATCACCTGCTGCGGCGAGGACGACGATCTCGTCCTCGACACCGTCCGCGCC
GCTTGCGACCTGGATTACCCCGATGATCGGTACAGGGTCATTGTGCTCGACGACGGCAAGTCGGCCGGCCTCGAG
GGCTCCGTCATCCGCATGACGGGCAACTACGCCAACCTGTATTACATGGCCCGCGAAAAGATACCCGGCAAGCCG
CACCACTTCAAGGCCGGCAATCTCAACTACGGACTGGACCTGGTCCACCGTCTCCCCGGCGGGGCTGGCCAATTC
ATGGCTGCCCTCGACGCCGACATGATTCCGGAGAGAGACTGGCTTCGCGCCATACTGCCTCACCTCCTCGTCGAC
CCCAAGATGGCTCTGGCGTGTCCCCCGCAACTGTTTTACAACACGCCCCCCTCTGATCCTCTCGCCCAGAGTCTC
GACTTCTTCGTCCACGTCATCGAGCCCATCAAGGACGCGCTCGGCGTTGCCTGGTGCACAGGCTCTGGCTACGTC
GCTCGTCGCGAGGCCCTCGACGACATTGGCAACTTTCCGCTGGGCTCTCTCGCCGAAGACGTCGCCACCTCGACG
CACATGCTGGGCAAGGGCTGGAAGACGGCCTACGTGCACGAGCCGCTGCAGTTTGGCACCGTGCCGGAGGACTAC
GGGAGCCACCTCAAACAGAGGACGCGCTGGGCGATTGGCACCGTCGACACGTCCTTCAAGCTCAACTTCTGCCTG
TGGGGTGAGCAGGTCCGGCAGATGACGTTTGCCCAGCGCTTCTCCGGCTTCCTCTACGCCACGCTCAGTCTGTAC
ACCATCGCCCTGACCGTCTCGCTCTTCGCCATCCCCATCATCCTCCTCATGGGCAAGACGCTGGTGGCCTATGCC
ACCGAGGAGCAGCTGCGGTGGCTGATCCGCATGTGCTTCGCCGCCACCATCTCCAACCGACTCTGCGAGTTCGTC
CTCTCCGTTCCCGCCGGCTACCACACGGGCCAGAGGAGCGCCCGTTACCAGTTGTGGATGGCGCCCTACATCGCC
CTCTGCATCGTCCGGTCTTTCGTCCTGCCGACCTGGCTCGGCGGCACGGCCCAGGCCTTTAAGCCGACCGGGTCC
CTCTCCTCGGCGCTCAACGAACGCGACCCGCTCCGCAAGAAGAATATGATCCGGCGGTTGTGGGCCATCCTGTTC
AACTACATGGGATTCTTCCACCTGGCCTTTGTCTACATGACGCTTGCGGGCGTGGCCATGACGTCGTTCCGCTGC
TTCGTCACGGCCACCAACCTCAAGGACATGCTGCTCTCGCTCGTGACGCACGCCTTCTGGCCGCCACTGACGTTC
ATCTTCATCTGCAGCTCGCTCTGGGTGCCGATAGCGTACGCCATTGACCCGCCCATGATGCCGGACCGCGAGGAG
CTGCTGGCGAGGGACCCCAAGACGCAGGTGGCGCATCCGACGCCGCGGAGCAAGAAGATTGCCTTTGGCGGGCAG
GCGGCCTGGTTCGAGCTCGAGCTGACGACGTCGACGCTCTTTACCGCCCTCATCTTTACCCTCTCGTTTTTGTTT
TAG
Gene >Ophio5|4506
ATGGCCGACACGCCCGACCTGGAGCGTCAACCCATGCCGTCGCCTCTTCAAGACACCCCTCTGGACCTGCGCCTG
ACCCTTGGCGATGCCGCGCCCGCTCCCCTGCAGCTCCACGATGAAAAGAACTGGTCTCCTCCATCTGCTACCGGC
AAGTCGGATTCACACACGCTCGTCAATAACCGTCAATCCGGCGGCAGCATCAGCTCCTGGCAGACGGGCCAGCAG
ACGCCCGTCAGCTCGGCCACGGCCATTAGCAAGTTCTCCGCCTTCAACTCCTACCCCTCGACTCCCATGGTGAGC
ATCCCATCCCGTCACTCACTTCGATCCGAGCTGCAGCTAATAAACGTCCAGAATCAGAGCAACATCAGCCTCGCC
GCTCTGCTACATAATTCTCTCCCACAGCCAGTCAGCAAAGAGTTCGCTGAGACTGCCGACTCGATTGCCGTCGTG
GGCGATCGAGACGACACCGACACCTGGCGTGGCTGGAGGCGTCACCTCTTCCGCCTCGTTCCCCTGCTCATCCTC
CTCAATTCCATCATCTACGTCCTGTACCTGGTTTACCGTATACTCTGTATCATTTGGTCTCAATGGCGGCACAAC
GAAACATATGTGGCCGCTTGGATTTTTATCGGCGTCGAGATCGCCGTTGCCATTCCTTCACTCATGCACAATTCC
TGGACAATGTGGTCCATGAAGAGACGGAGACGGCTCAAGCTGAGGCTCAAGGGCTACGAGGTTCCTACCGTCGAC
GTCTTCATCACCTGCTGCGGCGAGGACGACGATCTCGTCCTCGACACCGTCCGCGCCGCTTGCGACCTGGATTAC
CCCGATGATCGGTACAGGGTCATTGTGCTCGACGACGGCAAGTCGGCCGGCCTCGAGGGCTCCGTCATCCGCATG
ACGGGCAACTACGCCAACCTGTATTACATGGCCCGCGAAAAGATACCCGGCAAGCCGCACCACTTCAAGGCCGGC
AATCTCAACTACGGACTGGACCTGGTCCACCGTCTCCCCGGCGGGGCTGGCCAATTCATGGCTGCCCTCGACGCC
GACATGGTTCGTCGCCTAAAGTCTTGGATGGCTTCTTCCGCCTGTGCTGACCATTTGATCAGATTCCGGAGAGAG
ACTGGCTTCGCGCCATACTGCCTCACCTCCTCGTCGACCCCAAGATGGCTCTGGCGTGTCCCCCGCAACTGTTTT
ACAACACGCCCCCCTCTGATCCTCTCGCCCAGAGTCTCGACTTCTTCGTCCACGTCATCGAGCCCATCAAGGACG
CGCTCGGCGTTGCCTGGTGCACAGGCTCTGGCTACGTCGCTCGTCGCGAGGCCCTCGACGACATTGGCAACTTTC
CGCTGGGCTCTCTCGCCGAAGACGTCGCCACCTCGACGCACATGCTGGGCAAGGGCTGGAAGACGGCCTACGTGC
ACGAGCCGCTGCAGTTTGGCACCGTGCCGGAGGACTACGGGAGCCACCTCAAACAGAGGACGCGCTGGGCGATTG
GCACCGTCGACACGTCCTTCAAGCTCAACTTCTGCCTGTGGGGTGAGCAGGTCCGGCAGATGACGTTTGCCCAGC
GCTTCTCCGGCTTCCTCTACGCCACGCTCAGTCTGTACACCATCGCCCTGACCGTCTCGCTCTTCGCCATCCCCA
TCATCCTCCTCATGGGCAAGACGCTGGTGGCCTATGCCACCGAGGAGCAGCTGCGGTGGCTGATCCGCATGTGCT
TCGCCGCCACCATCTCCAACCGACTCTGCGAGTTCGTCCTCTCCGTTCCCGCCGGCTACCACACGGGCCAGAGGA
GCGCCCGTTACCAGTTGTGGATGGCGCCCTACATCGCCCTCTGCATCGTCCGGTCTTTCGTCCTGCCGACCTGGC
TCGGCGGCACGGCCCAGGCCTTTAAGCCGACCGGGTCCCTCTCCTCGGCGCTCAACGAACGCGACCCGCTCCGCA
AGAAGAATATGATCCGGCGGTTGTGGGCCATCCTGTTCAACTACATGGGATTCTTCCACCTGGCCTTTGTCTACA
TGACGCTTGCGGGCGTGGCCATGACGTCGTTCCGCTGCTTCGTCACGGCCACCAACCTCAAGGACATGCTGCTCT
CGCTCGTGACGCACGCCTTCTGGCCGCCACTGACGTTCATCTTCATCTGCAGCTCGCTCTGGGTGCCGATAGCGT
ACGCCATTGACCCGCCCATGATGCCGGACCGCGAGGAGCTGCTGGCGAGGGACCCCAAGACGCAGGTGGCGCATC
CGACGCCGCGGAGCAAGAAGATTGCCTTTGGCGGGCAGGCGGCCTGGTTCGAGCTCGAGCTGACGACGTCGACGC
TCTTTACCGCCCTCATCTTTACCCTCTCGTTTTTGTTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail