Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4505
Gene name
Locationscaffold_358:2314..3428
Strand-
Gene length (bp)1114
Transcript length (bp)885
Coding sequence length (bp)882
Protein length (aa) 294

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12 1.3E-23 47 288

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P22669|GUN_ASPAC Endoglucanase-1 OS=Aspergillus aculeatus PE=1 SV=1 45 289 6.0E-11
sp|A1CRJ0|XGEA_ASPCL Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=xgeA PE=3 SV=1 53 286 1.0E-10
sp|Q12679|GUNA_ASPKW Endoglucanase A OS=Aspergillus kawachii (strain NBRC 4308) GN=cekA PE=2 SV=2 118 288 4.0E-09
sp|G4NAZ1|CE12A_MAGO7 Endoglucanase cel12A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=cel12A PE=1 SV=1 44 289 5.0E-09
sp|Q0CRC9|XGEA_ASPTN Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=xgeA PE=3 SV=2 48 286 6.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P22669|GUN_ASPAC Endoglucanase-1 OS=Aspergillus aculeatus PE=1 SV=1 45 289 6.0E-11
sp|A1CRJ0|XGEA_ASPCL Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=xgeA PE=3 SV=1 53 286 1.0E-10
sp|Q12679|GUNA_ASPKW Endoglucanase A OS=Aspergillus kawachii (strain NBRC 4308) GN=cekA PE=2 SV=2 118 288 4.0E-09
sp|G4NAZ1|CE12A_MAGO7 Endoglucanase cel12A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=cel12A PE=1 SV=1 44 289 5.0E-09
sp|Q0CRC9|XGEA_ASPTN Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=xgeA PE=3 SV=2 48 286 6.0E-09
sp|A2Q877|XGEA_ASPNC Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=xgeA PE=3 SV=1 48 287 8.0E-09
sp|A1XP58|XGEA_ASPNG Xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus niger GN=xgeA PE=1 SV=1 48 287 1.0E-08
sp|A1D4F1|XGEA_NEOFI Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=xgeA PE=3 SV=1 48 288 7.0E-08
sp|Q5BG78|XGEA_EMENI Xyloglucan-specific endo-beta-1,4-glucanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=xgeA PE=1 SV=1 150 271 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008810 cellulase activity Yes
GO:0000272 polysaccharide catabolic process Yes
GO:0003824 catalytic activity No
GO:0043170 macromolecule metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0008152 metabolic process No
GO:0009056 catabolic process No
GO:0003674 molecular_function No
GO:0009057 macromolecule catabolic process No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:1901575 organic substance catabolic process No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0005975 carbohydrate metabolic process No
GO:0016052 carbohydrate catabolic process No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0005976 polysaccharide metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4505
MLRWLVNMHRHATGQPPLFTPPTTEEWLENTYCQKSYGIHPDTKGQQYTLNPNQWAMKAGDAGFLCMNVTTYSNQ
TYATSTTAPQFKVFWQYPQYKTGQPVHAYPNIKIDGDVLPAQLQTVSQIGVDFQWTMRLDNETGPTNSLAELMDS
NVNSNVAIDMFIDGDQEKAKDSQRADYEVMVWFAAIGPATYAIGQDLGPVMSKRVDGTNFNLYVGQNDRKQHVLT
WKATSMAHDFRGDLSPLIRQVLQTKRKGFPSDSDYLGYFSFGTEAYYSDRPVTFSVPSLSIDIQKTESS
Coding >Ophio5|4505
ATGCTTCGCTGGCTCGTAAACATGCATCGTCATGCGACGGGACAGCCGCCACTCTTTACTCCTCCGACCACCGAA
GAGTGGCTTGAGAACACGTACTGCCAGAAGTCGTACGGCATACATCCCGACACCAAGGGCCAGCAGTATACACTC
AATCCGAACCAATGGGCAATGAAGGCTGGCGATGCTGGTTTCCTCTGTATGAATGTGACGACGTACAGCAACCAA
ACTTATGCCACCTCGACGACGGCCCCCCAGTTCAAGGTCTTCTGGCAATATCCGCAGTATAAAACCGGACAGCCC
GTCCACGCCTATCCCAACATCAAGATTGACGGCGACGTGCTCCCCGCCCAGCTCCAGACCGTCAGCCAGATCGGC
GTCGACTTCCAATGGACCATGCGCCTCGATAATGAGACGGGCCCGACCAATAGTCTCGCCGAGCTGATGGACAGC
AACGTCAACTCCAACGTCGCCATCGACATGTTCATAGACGGCGACCAGGAAAAGGCCAAGGACAGTCAACGGGCC
GACTACGAAGTCATGGTCTGGTTCGCTGCCATCGGCCCGGCCACTTATGCCATTGGCCAAGATCTCGGTCCCGTC
ATGTCTAAGAGGGTCGACGGCACAAACTTTAACCTGTACGTCGGACAAAATGACCGCAAGCAGCACGTCCTCACC
TGGAAGGCTACGAGTATGGCCCACGATTTCCGGGGCGACTTATCGCCGCTCATCCGCCAGGTTCTCCAGACCAAA
CGCAAGGGCTTTCCCTCGGACTCGGACTACTTGGGATACTTTTCTTTCGGCACTGAGGCGTACTACTCAGACAGG
CCTGTTACATTTTCCGTGCCGTCCCTATCAATAGATATTCAAAAGACTGAGTCGTCA
Transcript >Ophio5|4505
ATGCTTCGCTGGCTCGTAAACATGCATCGTCATGCGACGGGACAGCCGCCACTCTTTACTCCTCCGACCACCGAA
GAGTGGCTTGAGAACACGTACTGCCAGAAGTCGTACGGCATACATCCCGACACCAAGGGCCAGCAGTATACACTC
AATCCGAACCAATGGGCAATGAAGGCTGGCGATGCTGGTTTCCTCTGTATGAATGTGACGACGTACAGCAACCAA
ACTTATGCCACCTCGACGACGGCCCCCCAGTTCAAGGTCTTCTGGCAATATCCGCAGTATAAAACCGGACAGCCC
GTCCACGCCTATCCCAACATCAAGATTGACGGCGACGTGCTCCCCGCCCAGCTCCAGACCGTCAGCCAGATCGGC
GTCGACTTCCAATGGACCATGCGCCTCGATAATGAGACGGGCCCGACCAATAGTCTCGCCGAGCTGATGGACAGC
AACGTCAACTCCAACGTCGCCATCGACATGTTCATAGACGGCGACCAGGAAAAGGCCAAGGACAGTCAACGGGCC
GACTACGAAGTCATGGTCTGGTTCGCTGCCATCGGCCCGGCCACTTATGCCATTGGCCAAGATCTCGGTCCCGTC
ATGTCTAAGAGGGTCGACGGCACAAACTTTAACCTGTACGTCGGACAAAATGACCGCAAGCAGCACGTCCTCACC
TGGAAGGCTACGAGTATGGCCCACGATTTCCGGGGCGACTTATCGCCGCTCATCCGCCAGGTTCTCCAGACCAAA
CGCAAGGGCTTTCCCTCGGACTCGGACTACTTGGGATACTTTTCTTTCGGCACTGAGGCGTACTACTCAGACAGG
CCTGTTACATTTTCCGTGCCGTCCCTATCAATAGATATTCAAAAGACTGAGTCGTCATGA
Gene >Ophio5|4505
ATGCTTCGCTGGCTCGTAAACGTCGGCTTCCTCACCCTGCCGATAGCCACCACGCTCGGCATCCTCATCGCGCTG
CAGATGCATCGTCATGCGACGGGACAGCCGCCACTCTTTACTCCTCCGACCACCGAAGAGTGGCTTGAGAACACG
TACTGCCAGAAGTCGTACGGCATACATCCCGACACCAAGGGCCAGCAGTATACACGTTCGTCTTCCCCAGTCTGC
TTCTCGCTTGGGCGCTGACCCGTCTGCGCTGCAGTCAATCCGAACCAATGGGCAATGAAGGCTGGCGATGCTGGT
TTCCTCTGTATGAATGTGAGTCTGGTCCACCGTCTCTGCTGGACTATCCAGGTGCTGACCACCCTCGTCCTCCAT
AGGTGACGACGTACAGCAACCAAACTTATGCCACCTCGACGACGGCCCCCCAGTTCAAGGTCTTCTGGCAATATC
CGCAGTATAAAACCGGACAGCCCGTCCACGCCTATCCCAACATCAAGATTGACGGCGACGTGCTCCCCGCCCAGC
TCCAGACCGTCAGCCAGATCGGCGTCGACTTCCAATGGACCATGCGCCTCGATAATGAGACGGGCCCGACCAATA
GTCTCGCCGAGCTGATGGACAGCAACGTCAACTCCAACGTCGCCATCGACATGTTCATAGACGGCGACCAGGAAA
AGGCCAAGGACAGTCAACGGGCCGACTACGAAGTCATGGTCTGGTTCGCTGCCATCGGCCCGGCCACTTATGCCA
TTGGCCAAGATCTCGGTCCCGTCATGTCTAAGAGGGTCGACGGCACAAACTTGTGAGCTATCCTCTCGGCCCCTA
TGCTCCCGTTCCCCTGCGGCTGACGTCCCCCAGTAACCTGTACGTCGGACAAAATGACCGCAAGCAGCACGTCCT
CACCTGGAAGGCTACGAGTATGGCCCACGATTTCCGGGGCGACTTATCGCCGCTCATCCGCCAGGTTCTCCAGAC
CAAACGCAAGGGCTTTCCCTCGGACTCGGACTACTTGGGATACTTTTCTTTCGGCACTGAGGCGTACTACTCAGA
CAGGCCTGTTACATTTTCCGTGCCGTCCCTATCAATAGATATTCAAAAGACTGAGTCGTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail