Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4503
Gene name
Locationscaffold_357:19194..20909
Strand-
Gene length (bp)1715
Transcript length (bp)1602
Coding sequence length (bp)1599
Protein length (aa) 533

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13520 AA_permease_2 Amino acid permease 2.8E-65 25 470
PF00324 AA_permease Amino acid permease 6.1E-34 39 479

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ZU50|BAT1_ARATH Amino-acid permease BAT1 OS=Arabidopsis thaliana GN=BAT1 PE=2 SV=2 7 489 8.0E-86
sp|P36029|TPO5_YEAST Polyamine transporter TPO5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO5 PE=1 SV=1 2 489 6.0E-85
sp|B9EXZ6|BAT1_ORYSJ Amino-acid permease BAT1 homolog OS=Oryza sativa subsp. japonica GN=BAT1 PE=2 SV=1 12 489 3.0E-80
sp|O60113|YG64_SCHPO Uncharacterized amino-acid permease C15C4.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.04c PE=3 SV=1 7 500 2.0E-67
sp|P19807|HNM1_YEAST Choline transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HNM1 PE=1 SV=1 18 486 2.0E-65
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ZU50|BAT1_ARATH Amino-acid permease BAT1 OS=Arabidopsis thaliana GN=BAT1 PE=2 SV=2 7 489 8.0E-86
sp|P36029|TPO5_YEAST Polyamine transporter TPO5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO5 PE=1 SV=1 2 489 6.0E-85
sp|B9EXZ6|BAT1_ORYSJ Amino-acid permease BAT1 homolog OS=Oryza sativa subsp. japonica GN=BAT1 PE=2 SV=1 12 489 3.0E-80
sp|O60113|YG64_SCHPO Uncharacterized amino-acid permease C15C4.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.04c PE=3 SV=1 7 500 2.0E-67
sp|P19807|HNM1_YEAST Choline transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HNM1 PE=1 SV=1 18 486 2.0E-65
sp|Q9US40|YFZ1_SCHPO Uncharacterized amino-acid permease C1039.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.01 PE=3 SV=1 2 489 4.0E-65
sp|O59942|AAP2_NEUCR Amino-acid permease 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=aap-2 PE=2 SV=2 8 489 2.0E-64
sp|O74537|YCQ4_SCHPO Uncharacterized amino-acid permease C74.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC74.04 PE=3 SV=1 7 491 5.0E-58
sp|Q09887|YC9D_SCHPO Uncharacterized amino-acid permease C584.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC584.13 PE=3 SV=1 2 489 2.0E-55
sp|O74248|GPT1_CANAX Putative polyamine transporter OS=Candida albicans GN=GPT1 PE=3 SV=1 3 504 3.0E-48
sp|Q9C0Z0|YKM2_SCHPO Uncharacterized amino-acid permease PB24D3.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB24D3.02c PE=3 SV=1 9 528 5.0E-45
sp|Q10087|YAO8_SCHPO Uncharacterized amino-acid permease C11D3.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.08c PE=3 SV=1 2 495 2.0E-39
sp|P32837|UGA4_YEAST GABA-specific permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UGA4 PE=1 SV=1 4 505 2.0E-39
sp|O59813|YCT3_SCHPO Uncharacterized amino-acid permease C794.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.03 PE=2 SV=1 5 484 1.0E-34
sp|P53744|BIO5_YEAST 7-keto 8-aminopelargonic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BIO5 PE=1 SV=1 3 476 9.0E-32
sp|Q9UT18|THI9_SCHPO Thiamine transporter thi9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=thi9 PE=1 SV=1 1 476 7.0E-29
sp|P0AA47|PLAP_ECOLI Low-affinity putrescine importer PlaP OS=Escherichia coli (strain K12) GN=plaP PE=1 SV=1 18 363 3.0E-10
sp|P0AA48|PLAP_ECO57 Low-affinity putrescine importer PlaP OS=Escherichia coli O157:H7 GN=plaP PE=3 SV=1 18 363 3.0E-10
sp|O34739|STET_BACSU Serine/threonine exchanger SteT OS=Bacillus subtilis (strain 168) GN=steT PE=1 SV=1 54 363 1.0E-06
sp|Q9ASS7|CAAT2_ARATH Cationic amino acid transporter 2, vacuolar OS=Arabidopsis thaliana GN=CAT2 PE=2 SV=1 79 409 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.5

Transmembrane Domains

Domain # Start End Length
1 30 52 22
2 62 93 31
3 113 135 22
4 150 169 19
5 176 198 22
6 225 247 22
7 260 282 22
8 309 331 22
9 364 386 22
10 390 412 22
11 425 447 22
12 462 481 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4503
MEDRRLSADRALAHLGYRAELPRNFSMMSILGLSFAIMAVPFGLSTTLYITLTNGQSVAVLYGWLLVSLISVCIA
ASLAEICAVFPTAGGVYYWSAMLSPRPWAPLVSFVDGWLTLVGNWTVTLSINFSGAQLILSAISIFNPDFVANQW
QTVLCFWALMLICALVNVFASRHLGLVNSVCLYWTAATVLIILVTLLATARHRRSAAFVFSHYDASASGWPSPWS
FFVGLLQPAYTLTGYGMVAAMCEEVQNPEREVPRAIVLSVVVAGITGVIYILPLLFVLPDVKMLLEVANSQPIGL
LFQTVTGSAAAGFALLFLILGILLFAGIGALTAASRCTYAFARDGAIPGHRLWSRVNKKLDMPLWALALSTLVDC
VLGCIYFGSSAAFNSFTGVATICLSTSYGVPVLVSLVRHRKHVRDSPFSLGKFGPFINAVCVVWIAFAVVIFCMP
VSLPVTASTMNYASVVFAGFAVIAVVWYFVYARRNFTGPPVIKADLLGQDLGQDVTVGKTIGGMPSNGAVSQESQ
QTSRKKKS
Coding >Ophio5|4503
ATGGAAGACCGTCGCCTCTCGGCCGACCGGGCCCTCGCCCATCTCGGCTACCGTGCCGAGCTTCCCCGCAACTTC
AGCATGATGAGCATCCTGGGCCTGTCCTTTGCCATCATGGCTGTGCCCTTTGGTCTCTCGACCACTCTCTACATC
ACCCTGACCAACGGCCAGTCCGTCGCCGTCCTCTACGGCTGGCTGCTCGTATCCCTCATCTCCGTCTGCATCGCA
GCCTCCCTTGCTGAGATATGCGCCGTCTTCCCCACCGCCGGTGGCGTCTATTACTGGTCCGCCATGCTCAGCCCT
CGGCCATGGGCGCCCCTCGTCAGCTTCGTCGACGGCTGGCTCACGCTTGTTGGTAACTGGACCGTCACCTTGTCC
ATCAACTTCTCCGGCGCCCAGCTTATCCTGAGCGCCATCTCCATCTTCAACCCCGACTTCGTCGCCAATCAGTGG
CAGACCGTTCTGTGCTTCTGGGCCTTGATGCTCATATGCGCCCTCGTCAACGTCTTTGCTTCCCGTCACCTCGGC
CTTGTCAACAGCGTCTGCCTCTATTGGACGGCCGCCACCGTCCTCATCATCCTCGTCACCCTCCTCGCCACCGCC
CGCCATCGCCGCTCCGCCGCCTTTGTCTTCTCACACTACGATGCCTCTGCCAGCGGCTGGCCATCGCCGTGGTCT
TTTTTTGTCGGCCTGTTGCAGCCCGCTTACACCCTCACCGGCTACGGCATGGTCGCCGCCATGTGCGAAGAGGTC
CAGAACCCCGAGCGCGAGGTGCCCCGTGCCATTGTCCTCTCCGTCGTCGTCGCCGGCATCACAGGCGTCATCTAC
ATCTTACCCCTGCTCTTCGTCTTGCCCGACGTCAAGATGCTGCTCGAGGTGGCCAATTCGCAACCCATCGGCCTC
CTCTTCCAGACCGTCACCGGCTCTGCTGCCGCCGGCTTCGCCCTGCTCTTCCTCATCCTCGGCATCCTCCTCTTC
GCCGGCATCGGCGCCCTGACGGCCGCCTCGCGCTGCACCTACGCCTTCGCCCGTGATGGCGCCATCCCGGGCCAC
AGGCTGTGGAGTCGCGTCAACAAGAAGCTCGACATGCCGCTGTGGGCGCTGGCCCTGTCCACCCTCGTCGATTGC
GTCCTCGGCTGCATCTACTTTGGCTCCTCGGCCGCCTTCAACTCCTTTACCGGCGTCGCCACCATCTGCCTCTCA
ACCTCGTACGGCGTTCCCGTCCTCGTGAGCCTCGTCCGCCACCGCAAGCATGTCCGCGACTCGCCCTTCTCCCTC
GGCAAATTTGGCCCCTTTATCAACGCCGTTTGTGTCGTTTGGATCGCCTTCGCCGTCGTCATCTTCTGCATGCCC
GTTTCCCTACCTGTCACTGCCAGCACTATGAATTACGCCTCCGTTGTCTTTGCCGGTTTCGCCGTCATCGCCGTC
GTCTGGTATTTCGTCTATGCTCGCCGCAACTTCACCGGCCCTCCCGTCATCAAGGCCGACCTTCTTGGCCAGGAC
CTCGGCCAGGACGTAACGGTTGGGAAAACGATCGGGGGCATGCCGAGCAACGGCGCCGTCTCGCAGGAATCGCAG
CAGACGTCTCGGAAAAAGAAGTCG
Transcript >Ophio5|4503
ATGGAAGACCGTCGCCTCTCGGCCGACCGGGCCCTCGCCCATCTCGGCTACCGTGCCGAGCTTCCCCGCAACTTC
AGCATGATGAGCATCCTGGGCCTGTCCTTTGCCATCATGGCTGTGCCCTTTGGTCTCTCGACCACTCTCTACATC
ACCCTGACCAACGGCCAGTCCGTCGCCGTCCTCTACGGCTGGCTGCTCGTATCCCTCATCTCCGTCTGCATCGCA
GCCTCCCTTGCTGAGATATGCGCCGTCTTCCCCACCGCCGGTGGCGTCTATTACTGGTCCGCCATGCTCAGCCCT
CGGCCATGGGCGCCCCTCGTCAGCTTCGTCGACGGCTGGCTCACGCTTGTTGGTAACTGGACCGTCACCTTGTCC
ATCAACTTCTCCGGCGCCCAGCTTATCCTGAGCGCCATCTCCATCTTCAACCCCGACTTCGTCGCCAATCAGTGG
CAGACCGTTCTGTGCTTCTGGGCCTTGATGCTCATATGCGCCCTCGTCAACGTCTTTGCTTCCCGTCACCTCGGC
CTTGTCAACAGCGTCTGCCTCTATTGGACGGCCGCCACCGTCCTCATCATCCTCGTCACCCTCCTCGCCACCGCC
CGCCATCGCCGCTCCGCCGCCTTTGTCTTCTCACACTACGATGCCTCTGCCAGCGGCTGGCCATCGCCGTGGTCT
TTTTTTGTCGGCCTGTTGCAGCCCGCTTACACCCTCACCGGCTACGGCATGGTCGCCGCCATGTGCGAAGAGGTC
CAGAACCCCGAGCGCGAGGTGCCCCGTGCCATTGTCCTCTCCGTCGTCGTCGCCGGCATCACAGGCGTCATCTAC
ATCTTACCCCTGCTCTTCGTCTTGCCCGACGTCAAGATGCTGCTCGAGGTGGCCAATTCGCAACCCATCGGCCTC
CTCTTCCAGACCGTCACCGGCTCTGCTGCCGCCGGCTTCGCCCTGCTCTTCCTCATCCTCGGCATCCTCCTCTTC
GCCGGCATCGGCGCCCTGACGGCCGCCTCGCGCTGCACCTACGCCTTCGCCCGTGATGGCGCCATCCCGGGCCAC
AGGCTGTGGAGTCGCGTCAACAAGAAGCTCGACATGCCGCTGTGGGCGCTGGCCCTGTCCACCCTCGTCGATTGC
GTCCTCGGCTGCATCTACTTTGGCTCCTCGGCCGCCTTCAACTCCTTTACCGGCGTCGCCACCATCTGCCTCTCA
ACCTCGTACGGCGTTCCCGTCCTCGTGAGCCTCGTCCGCCACCGCAAGCATGTCCGCGACTCGCCCTTCTCCCTC
GGCAAATTTGGCCCCTTTATCAACGCCGTTTGTGTCGTTTGGATCGCCTTCGCCGTCGTCATCTTCTGCATGCCC
GTTTCCCTACCTGTCACTGCCAGCACTATGAATTACGCCTCCGTTGTCTTTGCCGGTTTCGCCGTCATCGCCGTC
GTCTGGTATTTCGTCTATGCTCGCCGCAACTTCACCGGCCCTCCCGTCATCAAGGCCGACCTTCTTGGCCAGGAC
CTCGGCCAGGACGTAACGGTTGGGAAAACGATCGGGGGCATGCCGAGCAACGGCGCCGTCTCGCAGGAATCGCAG
CAGACGTCTCGGAAAAAGAAGTCGTAG
Gene >Ophio5|4503
ATGGAAGACCGTCGCCTCTCGGCCGACCGGGCCCTCGCCCATCTCGGCTACCGTGCCGAGCTTCCCCGCAACTTC
AGCATGATGAGCATCCTGGGCCTGTCCTTTGCCATCATGGCTGTGCCCTTTGGTCTCTCGACCACTCTCTACATC
ACCCTGACCAACGGCCAGTCCGTCGCCGTCCTCTACGGCTGGCTGCTCGTATCCCTCATCTCCGTCTGCATCGCA
GCCTCCCTTGCTGAGATATGCGCCGTCTTCCCCACCGCCGGTGGCGTCTATTACTGGTCCGCCATGCTCAGCCCT
CGGCCATGGGCGCCCCTCGTCAGCTTCGTCGACGGCTGGCTCACGCTTGTTGGTAACTGGACCGTCACCTTGTCC
ATCAACTTCTCCGGCGCCCAGCTTATCCTGAGCGCCATCTCCATCTTCAACCCCGACTTCGTCGCCAATCAGTGG
CAGACCGTTCTGTGCTTCTGGGCCTTGATGCTCATATGCGCCCTCGTCAACGTCTTTGCTTCCCGTCACCTCGGC
CTTGTCAACAGCGTCTGCCTCTATTGGACGGCCGCCACCGTCCTCATCATCCTCGTCACCCTCCTCGCCACCGCC
CGCCATCGCCGCTCCGCCGCCTTTGTCTTCTCACACTACGATGCCTCTGCCAGCGGCTGGCCATCGCCGTGGTCT
TTTTTTGTCGGCCTGTTGCAGCGTGAGCGGTTCCCCTCTCCCTCCCCCTCCCCCTCCCGTCAACACGAAAAGACA
GCATGCACATACCATCTCCATTCATGGCTGCTAATTCTCCTCGCTGACACTGACACACAGCCGCTTACACCCTCA
CCGGCTACGGCATGGTCGCCGCCATGTGCGAAGAGGTCCAGAACCCCGAGCGCGAGGTGCCCCGTGCCATTGTCC
TCTCCGTCGTCGTCGCCGGCATCACAGGCGTCATCTACATCTTACCCCTGCTCTTCGTCTTGCCCGACGTCAAGA
TGCTGCTCGAGGTGGCCAATTCGCAACCCATCGGCCTCCTCTTCCAGACCGTCACCGGCTCTGCTGCCGCCGGCT
TCGCCCTGCTCTTCCTCATCCTCGGCATCCTCCTCTTCGCCGGCATCGGCGCCCTGACGGCCGCCTCGCGCTGCA
CCTACGCCTTCGCCCGTGATGGCGCCATCCCGGGCCACAGGCTGTGGAGTCGCGTCAACAAGAAGCTCGACATGC
CGCTGTGGGCGCTGGCCCTGTCCACCCTCGTCGATTGCGTCCTCGGCTGCATCTACTTTGGCTCCTCGGCCGCCT
TCAACTCCTTTACCGGCGTCGCCACCATCTGCCTCTCAACCTCGTACGGCGTTCCCGTCCTCGTGAGCCTCGTCC
GCCACCGCAAGCATGTCCGCGACTCGCCCTTCTCCCTCGGCAAATTTGGCCCCTTTATCAACGCCGTTTGTGTCG
TTTGGATCGCCTTCGCCGTCGTCATCTTCTGCATGCCCGTTTCCCTACCTGTCACTGCCAGCACTATGAATTACG
CCTCCGTTGTCTTTGCCGGTTTCGCCGTCATCGCCGTCGTCTGGTATTTCGTCTATGCTCGCCGCAACTTCACCG
GCCCTCCCGTCATCAAGGCCGACCTTCTTGGCCAGGACCTCGGCCAGGACGTAACGGTTGGGAAAACGATCGGGG
GCATGCCGAGCAACGGCGCCGTCTCGCAGGAATCGCAGCAGACGTCTCGGAAAAAGAAGTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail