Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4500
Gene name
Locationscaffold_357:16221..16722
Strand-
Gene length (bp)501
Transcript length (bp)378
Coding sequence length (bp)375
Protein length (aa) 125

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00085 Thioredoxin Thioredoxin 8.1E-17 25 112

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USR1|TXL1_SCHPO Thioredoxin-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=txl1 PE=3 SV=1 11 118 1.0E-21
sp|P42115|THIO_NEUCR Thioredoxin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=trx PE=3 SV=1 8 114 1.0E-18
sp|Q8TFM8|THIO_FUSCU Thioredoxin-like protein OS=Fusarium culmorum PE=1 SV=1 11 118 2.0E-17
sp|P29429|THIO_EMENI Thioredoxin OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=TRX1 PE=1 SV=2 7 116 5.0E-17
sp|Q9UW02|THIO_COPCM Thioredoxin OS=Coprinus comatus PE=1 SV=1 14 112 1.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USR1|TXL1_SCHPO Thioredoxin-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=txl1 PE=3 SV=1 11 118 1.0E-21
sp|P42115|THIO_NEUCR Thioredoxin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=trx PE=3 SV=1 8 114 1.0E-18
sp|Q8TFM8|THIO_FUSCU Thioredoxin-like protein OS=Fusarium culmorum PE=1 SV=1 11 118 2.0E-17
sp|P29429|THIO_EMENI Thioredoxin OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=TRX1 PE=1 SV=2 7 116 5.0E-17
sp|Q9UW02|THIO_COPCM Thioredoxin OS=Coprinus comatus PE=1 SV=1 14 112 1.0E-15
sp|Q09433|THIO1_CAEEL Thioredoxin-1 OS=Caenorhabditis elegans GN=trx-1 PE=2 SV=1 20 117 4.0E-15
sp|Q6XHI1|THIO2_DROYA Thioredoxin-2 OS=Drosophila yakuba GN=Trx-2 PE=3 SV=1 11 112 6.0E-15
sp|O14463|TRX1_SCHPO Thioredoxin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trx1 PE=3 SV=3 11 112 6.0E-15
sp|Q9XIF4|TRXH7_ARATH Thioredoxin H7 OS=Arabidopsis thaliana GN=TRX7 PE=2 SV=1 11 116 2.0E-14
sp|Q7KQL8|THIO_PLAF7 Thioredoxin OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0545 PE=1 SV=1 11 116 2.0E-14
sp|P08628|THIO_RABIT Thioredoxin OS=Oryctolagus cuniculus GN=TXN PE=1 SV=2 11 114 2.0E-14
sp|Q39239|TRXH4_ARATH Thioredoxin H4 OS=Arabidopsis thaliana GN=TRX4 PE=3 SV=2 19 111 2.0E-14
sp|Q98TX1|THIO_OPHHA Thioredoxin OS=Ophiophagus hannah GN=TXN PE=3 SV=3 30 112 3.0E-14
sp|P29451|THIO_MACMU Thioredoxin OS=Macaca mulatta GN=TXN PE=3 SV=2 11 114 4.0E-14
sp|P10599|THIO_HUMAN Thioredoxin OS=Homo sapiens GN=TXN PE=1 SV=3 11 114 5.0E-14
sp|Q9V429|THIO2_DROME Thioredoxin-2 OS=Drosophila melanogaster GN=Trx-2 PE=1 SV=2 20 112 5.0E-14
sp|Q9DGI3|THIO_ICTPU Thioredoxin OS=Ictalurus punctatus GN=txn PE=3 SV=1 27 113 8.0E-14
sp|P50413|THIO_SHEEP Thioredoxin OS=Ovis aries GN=TXN PE=3 SV=2 11 114 1.0E-13
sp|P82460|THIO_PIG Thioredoxin OS=Sus scrofa GN=TXN PE=1 SV=3 11 114 1.0E-13
sp|Q9BDJ3|THIO_CALJA Thioredoxin OS=Callithrix jacchus GN=TXN PE=3 SV=3 11 114 2.0E-13
sp|O97508|THIO_HORSE Thioredoxin OS=Equus caballus GN=TXN PE=3 SV=3 11 114 2.0E-13
sp|P08629|THIO_CHICK Thioredoxin OS=Gallus gallus GN=TXN PE=3 SV=2 30 114 2.0E-13
sp|O97680|THIO_BOVIN Thioredoxin OS=Bos taurus GN=TXN PE=3 SV=3 11 114 2.0E-13
sp|P25372|TRX3_YEAST Thioredoxin-3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRX3 PE=1 SV=1 3 114 4.0E-13
sp|P22803|TRX2_YEAST Thioredoxin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRX2 PE=1 SV=3 11 111 6.0E-13
sp|Q9C9Y6|TRXH9_ARATH Thioredoxin H9 OS=Arabidopsis thaliana GN=TRX9 PE=1 SV=1 6 114 7.0E-13
sp|Q75GM1|TRXH5_ORYSJ Thioredoxin H5 OS=Oryza sativa subsp. japonica GN=Os05g0480200 PE=2 SV=1 6 115 8.0E-13
sp|Q9R6P9|THIO_MYCGA Thioredoxin OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=trxA PE=3 SV=2 14 94 1.0E-12
sp|P29447|THIO3_DICDI Thioredoxin-3 OS=Dictyostelium discoideum GN=trxC PE=3 SV=2 10 112 1.0E-12
sp|P22217|TRX1_YEAST Thioredoxin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRX1 PE=1 SV=3 11 111 1.0E-12
sp|Q5R9M3|THIO_PONAB Thioredoxin OS=Pongo abelii GN=TXN PE=3 SV=3 11 114 1.0E-12
sp|P34723|THIO_PENCH Thioredoxin OS=Penicillium chrysogenum GN=TRXA PE=1 SV=1 23 114 2.0E-12
sp|P29445|THIO1_DICDI Thioredoxin-1 OS=Dictyostelium discoideum GN=trxA PE=1 SV=1 8 112 5.0E-12
sp|Q39362|TRXH2_BRANA Thioredoxin H-type 2 OS=Brassica napus GN=THL-2 PE=2 SV=1 19 109 1.0E-11
sp|Q9TW67|NGLY1_CAEEL Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Caenorhabditis elegans GN=png-1 PE=1 SV=1 11 115 2.0E-11
sp|Q8VWG7|TDX_ARATH TPR repeat-containing thioredoxin TDX OS=Arabidopsis thaliana GN=TDX PE=1 SV=1 29 111 2.0E-11
sp|P10639|THIO_MOUSE Thioredoxin OS=Mus musculus GN=Txn PE=1 SV=3 14 111 3.0E-11
sp|O65049|TRXH_PICMA Thioredoxin H-type OS=Picea mariana GN=SB09 PE=2 SV=1 17 111 3.0E-11
sp|Q9SEU6|TRXM4_ARATH Thioredoxin M4, chloroplastic OS=Arabidopsis thaliana GN=At3g15360 PE=2 SV=2 10 112 3.0E-11
sp|Q38879|TRXH2_ARATH Thioredoxin H2 OS=Arabidopsis thaliana GN=TRX2 PE=2 SV=2 25 116 3.0E-11
sp|Q8S091|TRXF_ORYSJ Thioredoxin F, chloroplastic OS=Oryza sativa subsp. japonica GN=Os01g0913000 PE=2 SV=1 29 116 3.0E-11
sp|P11232|THIO_RAT Thioredoxin OS=Rattus norvegicus GN=Txn PE=1 SV=2 14 111 5.0E-11
sp|Q5WNE3|NGLY1_CAEBR Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Caenorhabditis briggsae GN=png-1 PE=3 SV=1 25 121 5.0E-11
sp|O17486|THIO_ECHGR Thioredoxin OS=Echinococcus granulosus GN=TRX PE=3 SV=2 20 112 5.0E-11
sp|Q6Z4I3|TRH21_ORYSJ Thioredoxin H2-1 OS=Oryza sativa subsp. japonica GN=Os07g0190800 PE=2 SV=1 14 111 1.0E-10
sp|Q8IFW4|THIOT_DROME Thioredoxin-T OS=Drosophila melanogaster GN=TrxT PE=2 SV=1 18 112 2.0E-10
sp|O48897|TRXF_BRANA Thioredoxin F-type, chloroplastic OS=Brassica napus GN=TRXF PE=2 SV=1 29 121 2.0E-10
sp|Q43636|TRXH_RICCO Thioredoxin H-type OS=Ricinus communis PE=3 SV=1 18 118 2.0E-10
sp|P29448|TRXH1_ARATH Thioredoxin H1 OS=Arabidopsis thaliana GN=TRX1 PE=1 SV=1 18 111 2.0E-10
sp|Q9XFH9|TRXF2_ARATH Thioredoxin F2, chloroplastic OS=Arabidopsis thaliana GN=At5g16400 PE=2 SV=1 29 116 3.0E-10
sp|O81332|TRXF_MESCR Thioredoxin F-type, chloroplastic OS=Mesembryanthemum crystallinum PE=2 SV=1 30 116 3.0E-10
sp|Q54KN7|THIO5_DICDI Putative thioredoxin-5 OS=Dictyostelium discoideum GN=trxE PE=3 SV=1 10 114 4.0E-10
sp|Q9XFH8|TRXF1_ARATH Thioredoxin F1, chloroplastic OS=Arabidopsis thaliana GN=At3g02730 PE=1 SV=2 29 120 5.0E-10
sp|Q9AS75|TRH41_ORYSJ Thioredoxin H4-1 OS=Oryza sativa subsp. japonica GN=Os01g0168200 PE=2 SV=1 29 111 6.0E-10
sp|P29450|TRXF_PEA Thioredoxin F-type, chloroplastic OS=Pisum sativum PE=2 SV=1 30 116 9.0E-10
sp|Q9LXZ8|TRH10_ARATH Putative thioredoxin H10 OS=Arabidopsis thaliana GN=At3g56420 PE=3 SV=2 25 109 1.0E-09
sp|P75512|THIO_MYCPN Thioredoxin OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=trxA PE=3 SV=1 11 95 1.0E-09
sp|Q9ZPH2|GRS17_ARATH Monothiol glutaredoxin-S17 OS=Arabidopsis thaliana GN=GRXS17 PE=1 SV=1 8 123 1.0E-09
sp|Q17424|THIO2_CAEEL Probable thioredoxin-2 OS=Caenorhabditis elegans GN=trx-2 PE=3 SV=2 30 116 2.0E-09
sp|P0AGG7|THIO2_SHIFL Thioredoxin-2 OS=Shigella flexneri GN=trxC PE=3 SV=1 16 102 2.0E-09
sp|P0AGG4|THIO2_ECOLI Thioredoxin-2 OS=Escherichia coli (strain K12) GN=trxC PE=1 SV=1 16 102 2.0E-09
sp|P0AGG5|THIO2_ECOL6 Thioredoxin-2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=trxC PE=3 SV=1 16 102 2.0E-09
sp|P0AGG6|THIO2_ECO57 Thioredoxin-2 OS=Escherichia coli O157:H7 GN=trxC PE=3 SV=1 16 102 2.0E-09
sp|Q42403|TRXH3_ARATH Thioredoxin H3 OS=Arabidopsis thaliana GN=TRX3 PE=1 SV=1 18 102 2.0E-09
sp|Q6NPF9|TRXY1_ARATH Thioredoxin Y1, chloroplastic OS=Arabidopsis thaliana GN=At1g76760 PE=2 SV=1 14 113 2.0E-09
sp|P29449|TRXH1_TOBAC Thioredoxin H-type 1 OS=Nicotiana tabacum PE=2 SV=1 24 111 3.0E-09
sp|Q7X8R5|TRXM2_ORYSJ Thioredoxin M2, chloroplastic OS=Oryza sativa subsp. japonica GN=Os04g0530600 PE=2 SV=2 7 112 3.0E-09
sp|P07591|TRXM_SPIOL Thioredoxin M-type, chloroplastic OS=Spinacia oleracea PE=1 SV=2 10 112 3.0E-09
sp|Q851R5|TRH22_ORYSJ Thioredoxin H2-2 OS=Oryza sativa subsp. japonica GN=Os03g0800700 PE=2 SV=1 27 111 4.0E-09
sp|Q0DKF1|TRH42_ORYSJ Thioredoxin H4-2 OS=Oryza sativa subsp. japonica GN=Os05g0169000 PE=2 SV=1 6 112 4.0E-09
sp|Q8N427|TXND3_HUMAN Thioredoxin domain-containing protein 3 OS=Homo sapiens GN=NME8 PE=2 SV=2 14 111 5.0E-09
sp|Q9CAS1|TRXH8_ARATH Thioredoxin H8 OS=Arabidopsis thaliana GN=TRX8 PE=2 SV=1 17 111 5.0E-09
sp|O94504|TRX2_SCHPO Thioredoxin-2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trx2 PE=1 SV=2 10 107 6.0E-09
sp|Q96419|TRXH_FAGES Thioredoxin H-type OS=Fagopyrum esculentum PE=3 SV=1 25 102 6.0E-09
sp|Q41864|TRXM_MAIZE Thioredoxin M-type, chloroplastic OS=Zea mays GN=TRM1 PE=2 SV=1 2 102 6.0E-09
sp|Q5JMR9|TRXY_ORYSJ Thioredoxin Y, chloroplastic OS=Oryza sativa subsp. japonica GN=Os01g0963400 PE=3 SV=2 14 102 8.0E-09
sp|P47370|THIO_MYCGE Thioredoxin OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=trxA PE=3 SV=1 11 93 8.0E-09
sp|P68176|TRXH_BRAOL Thioredoxin H-type OS=Brassica oleracea GN=BOPC17 PE=2 SV=1 18 117 9.0E-09
sp|P68177|TRXH1_BRANA Thioredoxin H-type 1 OS=Brassica napus GN=THL-1 PE=2 SV=1 18 117 9.0E-09
sp|Q6H7E4|TRXM1_ORYSJ Thioredoxin M1, chloroplastic OS=Oryza sativa subsp. japonica GN=Os02g0639900 PE=2 SV=1 7 102 9.0E-09
sp|P85801|TRXH_POPJC Thioredoxin H-type OS=Populus jackii PE=1 SV=1 36 114 9.0E-09
sp|P47938|THIO1_DROME Thioredoxin-1 OS=Drosophila melanogaster GN=dhd PE=1 SV=1 27 107 1.0E-08
sp|O64432|TRXH_BRACM Thioredoxin H-type OS=Brassica campestris GN=PEC-2 PE=2 SV=1 18 117 1.0E-08
sp|Q8L7S9|TRXY2_ARATH Thioredoxin Y2, chloroplastic OS=Arabidopsis thaliana GN=At1g43560 PE=2 SV=1 20 102 1.0E-08
sp|Q7M1B9|THIO_CHLAA Thioredoxin OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=trxA PE=1 SV=3 30 113 1.0E-08
sp|P48384|TRXM_PEA Thioredoxin M-type, chloroplastic OS=Pisum sativum PE=2 SV=1 36 112 1.0E-08
sp|O96952|THIO_GEOCY Thioredoxin OS=Geodia cydonium GN=THIO PE=3 SV=1 27 112 1.0E-08
sp|P09856|TRXF_SPIOL Thioredoxin F-type, chloroplastic OS=Spinacia oleracea PE=1 SV=2 30 116 1.0E-08
sp|Q69AB1|TXND8_RAT Thioredoxin domain-containing protein 8 OS=Rattus norvegicus GN=Txndc8 PE=2 SV=1 11 96 1.0E-08
sp|P60226|THIO1_DROYA Thioredoxin-1 OS=Drosophila yakuba GN=dhd PE=2 SV=2 27 107 2.0E-08
sp|Q39241|TRXH5_ARATH Thioredoxin H5 OS=Arabidopsis thaliana GN=TRX5 PE=1 SV=1 25 102 2.0E-08
sp|P50254|THIO_PYRYE Thioredoxin OS=Pyropia yezoensis GN=trxA PE=3 SV=1 7 102 2.0E-08
sp|Q86VQ3|TXND2_HUMAN Thioredoxin domain-containing protein 2 OS=Homo sapiens GN=TXNDC2 PE=2 SV=4 36 115 2.0E-08
sp|Q07090|TRXH2_TOBAC Thioredoxin H-type 2 OS=Nicotiana tabacum PE=3 SV=1 18 111 2.0E-08
sp|P80028|TRXH_CHLRE Thioredoxin H-type OS=Chlamydomonas reinhardtii GN=TRXH PE=1 SV=3 14 111 2.0E-08
sp|P29446|THIO2_DICDI Thioredoxin-2 (Fragment) OS=Dictyostelium discoideum GN=trxB PE=2 SV=1 10 99 2.0E-08
sp|P37395|THIO_CYACA Thioredoxin OS=Cyanidium caldarium GN=trxA PE=3 SV=1 23 112 3.0E-08
sp|P9WG67|THIO_MYCTU Thioredoxin OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=trxA PE=1 SV=1 23 114 3.0E-08
sp|P9WG66|THIO_MYCTO Thioredoxin OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=trxA PE=3 SV=1 23 114 3.0E-08
sp|P0A617|THIO_MYCBO Thioredoxin OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=trxA PE=3 SV=2 23 114 3.0E-08
sp|Q39591|DYL4_CHLRE Dynein 14 kDa light chain, flagellar outer arm OS=Chlamydomonas reinhardtii PE=1 SV=1 31 117 4.0E-08
sp|O51088|THIO_BORBU Thioredoxin OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=trxA PE=3 SV=1 31 89 5.0E-08
sp|Q8GXV2|CXXS2_ARATH Thioredoxin-like protein CXXS2 OS=Arabidopsis thaliana GN=CXXS2 PE=2 SV=1 29 109 6.0E-08
sp|P23400|TRXM_CHLRE Thioredoxin M-type, chloroplastic OS=Chlamydomonas reinhardtii GN=TRXM PE=1 SV=3 23 112 6.0E-08
sp|Q69AB2|TXND8_MOUSE Thioredoxin domain-containing protein 8 OS=Mus musculus GN=Txndc8 PE=1 SV=1 27 96 8.0E-08
sp|Q9RD25|THIO2_STRCO Putative thioredoxin-2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trxC PE=2 SV=1 16 89 9.0E-08
sp|Q6ES52|TDX_ORYSJ TPR repeat-containing thioredoxin TDX OS=Oryza sativa subsp. japonica GN=Os09g0401200 PE=2 SV=1 29 111 9.0E-08
sp|Q9ZP20|TRXM5_ORYSJ Thioredoxin M5, chloroplastic OS=Oryza sativa subsp. japonica GN=TRXM PE=2 SV=1 28 113 9.0E-08
sp|P51225|THIO_PORPU Thioredoxin OS=Porphyra purpurea GN=trxA PE=3 SV=1 7 102 9.0E-08
sp|Q942L2|PDI22_ORYSJ Protein disulfide isomerase-like 2-2 OS=Oryza sativa subsp. japonica GN=PDIL2-2 PE=2 SV=1 23 95 9.0E-08
sp|A2YIW7|TRXH_ORYSI Thioredoxin H-type OS=Oryza sativa subsp. indica GN=TRXH PE=1 SV=1 15 111 1.0E-07
sp|Q0D840|TRXH1_ORYSJ Thioredoxin H1 OS=Oryza sativa subsp. japonica GN=TRXH PE=1 SV=1 15 111 1.0E-07
sp|P10472|THIO_CHLTI Thioredoxin OS=Chlorobaculum thiosulfatiphilum GN=trxA PE=1 SV=5 23 102 1.0E-07
sp|Q53LQ0|PDI11_ORYSJ Protein disulfide isomerase-like 1-1 OS=Oryza sativa subsp. japonica GN=PDIL1-1 PE=2 SV=1 20 105 1.0E-07
sp|Q86XW9|TXND6_HUMAN Thioredoxin domain-containing protein 6 OS=Homo sapiens GN=NME9 PE=2 SV=1 13 113 1.0E-07
sp|Q10057|PDI1_SCHPO Putative protein disulfide-isomerase C1F5.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.02 PE=3 SV=1 7 101 1.0E-07
sp|P50338|THIO_GRIPA Thioredoxin OS=Griffithsia pacifica GN=trxA PE=3 SV=2 26 102 2.0E-07
sp|P05307|PDIA1_BOVIN Protein disulfide-isomerase OS=Bos taurus GN=P4HB PE=1 SV=1 17 94 2.0E-07
sp|P07887|THIO2_CORNE Thioredoxin C-2 OS=Corynebacterium nephridii PE=1 SV=3 19 102 2.0E-07
sp|Q9CM49|THIO_PASMU Thioredoxin OS=Pasteurella multocida (strain Pm70) GN=trxA PE=3 SV=1 30 102 2.0E-07
sp|P52232|THIO1_SYNY3 Thioredoxin-like protein slr0233 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0233 PE=1 SV=1 35 102 2.0E-07
sp|P00275|THIO1_CORNE Thioredoxin C-1 OS=Corynebacterium nephridii PE=1 SV=1 16 102 2.0E-07
sp|O64764|TRXO1_ARATH Thioredoxin O1, mitochondrial OS=Arabidopsis thaliana GN=At2g35010 PE=2 SV=1 31 114 2.0E-07
sp|Q13087|PDIA2_HUMAN Protein disulfide-isomerase A2 OS=Homo sapiens GN=PDIA2 PE=1 SV=2 14 97 3.0E-07
sp|P46843|TRXB_MYCLE Bifunctional thioredoxin reductase/thioredoxin OS=Mycobacterium leprae (strain TN) GN=trxB/A PE=3 SV=1 23 114 4.0E-07
sp|Q5UR29|TR548_MIMIV Thioredoxin-like protein R548 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R548 PE=3 SV=1 29 111 4.0E-07
sp|P54399|PDI_DROME Protein disulfide-isomerase OS=Drosophila melanogaster GN=Pdi PE=2 SV=1 23 107 6.0E-07
sp|P0A4L3|THIO_LISMO Thioredoxin OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=trxA PE=3 SV=1 36 101 7.0E-07
sp|P0A4L4|THIO_LISIN Thioredoxin OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=trxA PE=3 SV=1 36 101 7.0E-07
sp|Q6P902|TXND2_MOUSE Thioredoxin domain-containing protein 2 OS=Mus musculus GN=Txndc2 PE=1 SV=1 36 115 8.0E-07
sp|O48737|TRXM1_ARATH Thioredoxin M1, chloroplastic OS=Arabidopsis thaliana GN=At1g03680 PE=2 SV=1 36 102 9.0E-07
sp|P07237|PDIA1_HUMAN Protein disulfide-isomerase OS=Homo sapiens GN=P4HB PE=1 SV=3 29 94 1.0E-06
sp|P66928|THIO_HELPY Thioredoxin OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=trxA PE=3 SV=1 36 102 1.0E-06
sp|P66929|THIO_HELPJ Thioredoxin OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=trxA PE=3 SV=1 36 102 1.0E-06
sp|Q86H62|GLRX3_DICDI Glutaredoxin-3 homolog OS=Dictyostelium discoideum GN=glrx3 PE=3 SV=1 14 107 1.0E-06
sp|Q2HWU2|PDIA1_MACFU Protein disulfide-isomerase OS=Macaca fuscata fuscata GN=P4HB PE=2 SV=1 29 94 1.0E-06
sp|Q5R5B6|PDIA1_PONAB Protein disulfide-isomerase OS=Pongo abelii GN=P4HB PE=2 SV=1 24 94 1.0E-06
sp|Q93VQ9|TRXO2_ARATH Thioredoxin O2, mitochondrial OS=Arabidopsis thaliana GN=At1g31020 PE=2 SV=1 31 114 1.0E-06
sp|O22022|THIO_CYAME Thioredoxin OS=Cyanidioschyzon merolae GN=trxA PE=3 SV=1 23 102 1.0E-06
sp|Q5RCH2|PDIA2_PONAB Protein disulfide-isomerase A2 OS=Pongo abelii GN=PDIA2 PE=2 SV=1 14 97 2.0E-06
sp|Q715T0|TXND3_MOUSE Thioredoxin domain-containing protein 3 OS=Mus musculus GN=Nme8 PE=2 SV=1 14 111 2.0E-06
sp|Q54EN4|PDI2_DICDI Protein disulfide-isomerase 2 OS=Dictyostelium discoideum GN=pdi2 PE=3 SV=1 35 94 2.0E-06
sp|Q1ZXE0|THIO4_DICDI Putative thioredoxin-4 OS=Dictyostelium discoideum GN=trxD PE=3 SV=2 10 115 2.0E-06
sp|P80579|THIO_ALIAC Thioredoxin OS=Alicyclobacillus acidocaldarius GN=trxA PE=1 SV=1 36 101 2.0E-06
sp|P0A4L2|THIO1_NOSSO Thioredoxin-1 OS=Nostoc sp. (strain ATCC 29151 / PCC 7119) GN=trxA PE=1 SV=2 23 112 2.0E-06
sp|P0A4L1|THIO1_NOSS1 Thioredoxin-1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=trxA PE=3 SV=2 23 112 2.0E-06
sp|Q75M08|PDI21_ORYSJ Protein disulfide isomerase-like 2-1 OS=Oryza sativa subsp. japonica GN=PDIL2-1 PE=2 SV=2 23 95 2.0E-06
sp|P52588|PDI_MAIZE Protein disulfide-isomerase OS=Zea mays GN=PDI PE=2 SV=1 20 105 2.0E-06
sp|P80284|PDI_HORVU Protein disulfide-isomerase OS=Hordeum vulgare GN=PDI PE=1 SV=2 20 122 3.0E-06
sp|P21195|PDIA1_RABIT Protein disulfide-isomerase OS=Oryctolagus cuniculus GN=P4HB PE=2 SV=1 30 94 3.0E-06
sp|Q8VX13|PDI13_ARATH Protein disulfide isomerase-like 1-3 OS=Arabidopsis thaliana GN=PDIL1-3 PE=2 SV=1 2 101 3.0E-06
sp|P09102|PDIA1_CHICK Protein disulfide-isomerase OS=Gallus gallus GN=P4HB PE=1 SV=3 30 95 3.0E-06
sp|Q5XJ54|GLRX3_DANRE Glutaredoxin 3 OS=Danio rerio GN=glrx3 PE=2 SV=1 13 112 3.0E-06
sp|Q715S9|TXND3_RAT Thioredoxin domain-containing protein 3 OS=Rattus norvegicus GN=Nme8 PE=2 SV=2 14 111 4.0E-06
sp|P52589|PDI_WHEAT Protein disulfide-isomerase OS=Triticum aestivum GN=PDI PE=2 SV=1 19 122 4.0E-06
sp|P38661|PDIA6_MEDSA Probable protein disulfide-isomerase A6 OS=Medicago sativa PE=2 SV=1 11 95 6.0E-06
sp|Q9FF55|PDI14_ARATH Protein disulfide isomerase-like 1-4 OS=Arabidopsis thaliana GN=PDIL1-4 PE=1 SV=1 12 94 7.0E-06
sp|Q5XHX6|TXND2_RAT Thioredoxin domain-containing protein 2 OS=Rattus norvegicus GN=Txndc2 PE=1 SV=2 36 115 7.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6927 0.3572 0.0298 0.1077 0.29 0.0039 0.2236 0.1903 0.1239 0.0345

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup279
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4592
Ophiocordyceps australis map64 (Brazil) OphauB2|8117
Ophiocordyceps camponoti-floridani Ophcf2|01675
Ophiocordyceps camponoti-floridani Ophcf2|05204
Ophiocordyceps camponoti-rufipedis Ophun1|5093
Ophiocordyceps camponoti-rufipedis Ophun1|5409
Ophiocordyceps kimflemingae Ophio5|4500 (this protein)
Ophiocordyceps kimflemingae Ophio5|4716
Ophiocordyceps subramaniannii Hirsu2|4530
Ophiocordyceps subramaniannii Hirsu2|5995
Ophiocordyceps subramaniannii Hirsu2|6830

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4500
MSENAYSSDKVPDIESKQQLDGLLDRNPFLVLQAHATWCAPCKAISPLFRQQAEDLARPEVLAFARFDSGRAEDL
VHELGIQTLPTFVFFENGEKIQSLTGANHATLQKAVEDIRAKADAAFPRR
Coding >Ophio5|4500
ATGAGCGAAAACGCCTACTCAAGCGACAAAGTCCCCGACATCGAATCCAAGCAACAACTCGACGGCCTCCTCGAC
CGAAATCCCTTCCTCGTCCTTCAAGCCCACGCCACCTGGTGCGCACCTTGCAAGGCCATCTCACCGCTCTTCCGC
CAGCAAGCCGAAGACCTCGCCCGCCCCGAGGTGCTGGCCTTTGCCCGCTTCGACTCCGGCCGCGCCGAGGACCTG
GTGCACGAGCTCGGCATCCAGACGCTTCCCACCTTTGTCTTCTTCGAGAATGGCGAGAAGATCCAGTCGTTGACG
GGGGCAAATCATGCTACTTTGCAAAAGGCCGTAGAAGATATCAGGGCCAAGGCCGACGCTGCCTTTCCCCGCCGA
Transcript >Ophio5|4500
ATGAGCGAAAACGCCTACTCAAGCGACAAAGTCCCCGACATCGAATCCAAGCAACAACTCGACGGCCTCCTCGAC
CGAAATCCCTTCCTCGTCCTTCAAGCCCACGCCACCTGGTGCGCACCTTGCAAGGCCATCTCACCGCTCTTCCGC
CAGCAAGCCGAAGACCTCGCCCGCCCCGAGGTGCTGGCCTTTGCCCGCTTCGACTCCGGCCGCGCCGAGGACCTG
GTGCACGAGCTCGGCATCCAGACGCTTCCCACCTTTGTCTTCTTCGAGAATGGCGAGAAGATCCAGTCGTTGACG
GGGGCAAATCATGCTACTTTGCAAAAGGCCGTAGAAGATATCAGGGCCAAGGCCGACGCTGCCTTTCCCCGCCGA
TGA
Gene >Ophio5|4500
ATGAGCGAAAACGCCTACTCAAGCGACAAAGTCCCCGACATCGAATCCAAGCAACAACTCGACGGCCTCCTCGAC
CGAAATCCCTTCCTCGTCCTTCAAGCCCACGCCACCTGGTGCGCACCTTGCAAGGCCATCTCACCGCTCTTCCGC
CAGCAAGCCGAAGACCTCGCCCGCCCCGAGGTGCTGGCCTTTGCCCGCTTCGACTCCGGCCGCGCCGAGGACCTG
GTGCACGAGCTCGGCATCCAGACGCTTCCCACCTTTGTCTTCTTCGAGAATGGCGAGAAGATCCAGTCGTTGACG
GGGGCAAATCATGCTACTTTGCAAAAGGCCGTAGAAGATATCAGGGCCAAGGCCGACGCTGCCGTGAGTATCCCG
TGTCTGGTTTTGGTCTCTCTCTTCTCTGCATGTCTGGCCTTTTCCTTCCCTGTTCCATGTCACTGTCTCGGGATT
TTCCGTCTCTGCATGTCTGACTCTCTGGCTCTTTAGTTTCCCCGCCGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail