Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4494
Gene name
Locationscaffold_357:2815..4517
Strand+
Gene length (bp)1702
Transcript length (bp)1434
Coding sequence length (bp)1431
Protein length (aa) 477

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08606 Prp19 Prp19/Pso4-like 6.8E-29 66 131

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14011|PRP19_SCHPO Pre-mRNA-processing factor 19 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp19 PE=1 SV=1 1 469 2.0E-78
sp|Q9AV81|PRP19_ORYSJ Pre-mRNA-processing factor 19 OS=Oryza sativa subsp. japonica GN=PRP19 PE=2 SV=1 1 464 2.0E-67
sp|Q7KWK5|PRP19_DICDI Pre-mRNA-processing factor 19 OS=Dictyostelium discoideum GN=prp19 PE=3 SV=1 1 437 2.0E-67
sp|Q9UMS4|PRP19_HUMAN Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1 1 474 6.0E-64
sp|Q08E38|PRP19_BOVIN Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1 1 474 2.0E-63
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14011|PRP19_SCHPO Pre-mRNA-processing factor 19 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp19 PE=1 SV=1 1 469 2.0E-78
sp|Q9AV81|PRP19_ORYSJ Pre-mRNA-processing factor 19 OS=Oryza sativa subsp. japonica GN=PRP19 PE=2 SV=1 1 464 2.0E-67
sp|Q7KWK5|PRP19_DICDI Pre-mRNA-processing factor 19 OS=Dictyostelium discoideum GN=prp19 PE=3 SV=1 1 437 2.0E-67
sp|Q9UMS4|PRP19_HUMAN Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1 1 474 6.0E-64
sp|Q08E38|PRP19_BOVIN Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1 1 474 2.0E-63
sp|Q9JMJ4|PRP19_RAT Pre-mRNA-processing factor 19 OS=Rattus norvegicus GN=Prpf19 PE=1 SV=2 1 474 4.0E-63
sp|Q99KP6|PRP19_MOUSE Pre-mRNA-processing factor 19 OS=Mus musculus GN=Prpf19 PE=1 SV=1 1 474 4.0E-63
sp|O22785|PR19B_ARATH Pre-mRNA-processing factor 19 homolog 2 OS=Arabidopsis thaliana GN=PRP19B PE=1 SV=3 1 464 6.0E-61
sp|Q5ZMA2|PRP19_CHICK Pre-mRNA-processing factor 19 OS=Gallus gallus GN=PRPF19 PE=1 SV=1 1 474 6.0E-61
sp|Q10051|PRP19_CAEEL Pre-mRNA-processing factor 19 OS=Caenorhabditis elegans GN=prp-19 PE=3 SV=2 1 472 4.0E-59
sp|Q94BR4|PR19A_ARATH Pre-mRNA-processing factor 19 homolog 1 OS=Arabidopsis thaliana GN=PRP19A PE=1 SV=1 1 464 5.0E-59
sp|P32523|PRP19_YEAST Pre-mRNA-processing factor 19 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP19 PE=1 SV=2 1 145 3.0E-22
sp|Q01369|GBLP_NEUCR Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1 282 421 2.0E-07
sp|Q2TBP4|POC1A_BOVIN POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 248 423 5.0E-07
sp|Q8JZX3|POC1A_MOUSE POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 248 423 1.0E-06
sp|Q8NBT0|POC1A_HUMAN POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 248 423 3.0E-06
sp|O42249|GBLP_ORENI Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Oreochromis niloticus GN=gnb2l1 PE=2 SV=1 282 421 3.0E-06
sp|P33215|NEDD1_MOUSE Protein NEDD1 OS=Mus musculus GN=Nedd1 PE=1 SV=2 211 350 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4494
MLCSISGESPQEPVVSKKSGFVYEKRLIEQYVNDHGTEPGTGQGLTVDDLLSLKDSTIVRPRPPTLTSIPALLAT
FQNEWDALALETYNLKEQLARTREELATLLYQQDAAVRVIVRLTRERDEARESLSKVTVGGGPVGVEEMVVDSVE
PLPDELAERVDETHKRLTKSRKKRPIPEGWASADDISALETVASSSVSLSHPTSLDLQEEHAALGDSQGEAVIYS
LQAEAVERQLSVGQPIMDTLWAGTKLVFATGRGAVKVYEGGKEATSASDHAGPATALSTHPGGEILASVGADKSI
VFYDLGSMKRVGRVFTDSSLNKCAFHPDGHLFAAGAVSGDIKLFMTQTLEQAAAFSLGAPIEALSFSENGFWLAA
TAKGQSIVTIFDLRKEGDAAMAKVLEIGGPVQSLAWDLTGQFLATGGAGGVTVQHYAKSSKKWSEPFRNSVSAVA
VRWGPSARKLIAVGDDGVVAVYRVKED
Coding >Ophio5|4494
ATGCTCTGCTCAATTTCCGGCGAGTCGCCCCAAGAGCCTGTCGTCTCCAAAAAGTCGGGCTTTGTCTACGAGAAG
CGCCTGATCGAGCAATACGTGAATGATCACGGCACCGAGCCTGGCACGGGCCAAGGGCTGACCGTCGACGATCTG
CTCTCACTCAAGGACTCGACCATCGTTCGTCCGCGCCCTCCCACGCTCACGTCGATCCCTGCTTTGCTCGCCACT
TTCCAGAACGAGTGGGATGCGCTGGCTCTGGAAACCTACAATCTCAAGGAGCAGCTGGCTCGGACGCGAGAGGAG
CTGGCGACGCTTCTCTACCAGCAGGATGCCGCTGTCCGCGTCATTGTCCGCCTGACGAGGGAGAGGGACGAGGCT
AGAGAGTCATTAAGCAAGGTCACCGTGGGAGGAGGCCCAGTAGGTGTGGAGGAAATGGTGGTCGACAGCGTCGAA
CCGCTTCCTGACGAGCTGGCTGAGCGCGTCGACGAAACCCACAAGAGACTGACCAAGAGCCGGAAGAAGCGGCCG
ATACCCGAAGGCTGGGCCTCTGCAGACGATATTTCTGCTTTGGAGACGGTCGCGTCCAGTTCCGTCTCGCTCTCG
CACCCCACCTCTCTCGACCTGCAGGAGGAACATGCCGCGCTGGGCGATTCCCAGGGTGAGGCCGTCATCTACTCG
CTTCAGGCGGAAGCGGTGGAGCGGCAGCTGTCCGTTGGCCAGCCCATAATGGACACGCTCTGGGCCGGGACAAAA
CTTGTCTTCGCCACGGGCCGAGGCGCTGTCAAAGTGTACGAAGGCGGCAAAGAGGCAACCTCCGCCTCGGACCAT
GCCGGTCCCGCCACGGCCCTGAGCACCCACCCCGGCGGCGAGATTCTAGCCTCCGTTGGGGCCGACAAAAGTATC
GTCTTCTACGACCTGGGCTCTATGAAGCGCGTTGGACGCGTCTTCACTGATAGCTCTCTAAACAAGTGCGCCTTC
CATCCCGACGGCCACCTCTTCGCCGCGGGCGCCGTTTCGGGCGACATCAAGCTCTTCATGACCCAAACGCTCGAG
CAGGCTGCCGCCTTCAGCCTCGGCGCGCCCATCGAGGCCCTCTCGTTCTCCGAGAACGGATTCTGGCTGGCGGCG
ACAGCCAAAGGGCAGAGCATCGTCACCATCTTCGATCTACGGAAGGAGGGCGACGCGGCGATGGCCAAGGTGCTC
GAGATTGGCGGCCCGGTGCAGTCGCTGGCCTGGGACTTGACCGGGCAGTTCCTGGCGACGGGCGGCGCCGGCGGC
GTGACGGTGCAGCACTACGCCAAGTCGAGCAAGAAATGGAGCGAGCCTTTCCGGAACTCCGTGTCTGCCGTGGCC
GTCCGATGGGGGCCGTCGGCTAGGAAGCTCATTGCTGTGGGCGACGACGGCGTCGTGGCGGTTTACAGGGTCAAG
GAGGAT
Transcript >Ophio5|4494
ATGCTCTGCTCAATTTCCGGCGAGTCGCCCCAAGAGCCTGTCGTCTCCAAAAAGTCGGGCTTTGTCTACGAGAAG
CGCCTGATCGAGCAATACGTGAATGATCACGGCACCGAGCCTGGCACGGGCCAAGGGCTGACCGTCGACGATCTG
CTCTCACTCAAGGACTCGACCATCGTTCGTCCGCGCCCTCCCACGCTCACGTCGATCCCTGCTTTGCTCGCCACT
TTCCAGAACGAGTGGGATGCGCTGGCTCTGGAAACCTACAATCTCAAGGAGCAGCTGGCTCGGACGCGAGAGGAG
CTGGCGACGCTTCTCTACCAGCAGGATGCCGCTGTCCGCGTCATTGTCCGCCTGACGAGGGAGAGGGACGAGGCT
AGAGAGTCATTAAGCAAGGTCACCGTGGGAGGAGGCCCAGTAGGTGTGGAGGAAATGGTGGTCGACAGCGTCGAA
CCGCTTCCTGACGAGCTGGCTGAGCGCGTCGACGAAACCCACAAGAGACTGACCAAGAGCCGGAAGAAGCGGCCG
ATACCCGAAGGCTGGGCCTCTGCAGACGATATTTCTGCTTTGGAGACGGTCGCGTCCAGTTCCGTCTCGCTCTCG
CACCCCACCTCTCTCGACCTGCAGGAGGAACATGCCGCGCTGGGCGATTCCCAGGGTGAGGCCGTCATCTACTCG
CTTCAGGCGGAAGCGGTGGAGCGGCAGCTGTCCGTTGGCCAGCCCATAATGGACACGCTCTGGGCCGGGACAAAA
CTTGTCTTCGCCACGGGCCGAGGCGCTGTCAAAGTGTACGAAGGCGGCAAAGAGGCAACCTCCGCCTCGGACCAT
GCCGGTCCCGCCACGGCCCTGAGCACCCACCCCGGCGGCGAGATTCTAGCCTCCGTTGGGGCCGACAAAAGTATC
GTCTTCTACGACCTGGGCTCTATGAAGCGCGTTGGACGCGTCTTCACTGATAGCTCTCTAAACAAGTGCGCCTTC
CATCCCGACGGCCACCTCTTCGCCGCGGGCGCCGTTTCGGGCGACATCAAGCTCTTCATGACCCAAACGCTCGAG
CAGGCTGCCGCCTTCAGCCTCGGCGCGCCCATCGAGGCCCTCTCGTTCTCCGAGAACGGATTCTGGCTGGCGGCG
ACAGCCAAAGGGCAGAGCATCGTCACCATCTTCGATCTACGGAAGGAGGGCGACGCGGCGATGGCCAAGGTGCTC
GAGATTGGCGGCCCGGTGCAGTCGCTGGCCTGGGACTTGACCGGGCAGTTCCTGGCGACGGGCGGCGCCGGCGGC
GTGACGGTGCAGCACTACGCCAAGTCGAGCAAGAAATGGAGCGAGCCTTTCCGGAACTCCGTGTCTGCCGTGGCC
GTCCGATGGGGGCCGTCGGCTAGGAAGCTCATTGCTGTGGGCGACGACGGCGTCGTGGCGGTTTACAGGGTCAAG
GAGGATTGA
Gene >Ophio5|4494
ATGCTCTGCTCAAGTGACTACCGCCTCGATTTCTTCTGCTGGACGTGTTTTTGCTGACCGGGAACCACAGTTTCC
GGCGAGTCGCCCCAAGAGCCTGTCGTCTCCAAAAAGTCGGGTACGCGAACCCTTCCCCCCTGCTTCGAGCAGCTT
CCAGCCTTGGGCGCAAACTGACGGCCATACCGCACAGGCTTTGTCTACGAGAAGCGCCTGATCGAGCAATACGTG
AATGATCACGGCACCGAGCCTGGCACGGGCCAAGGGCTGACCGTCGACGATCTGCTCTCACTCAAGGACTCGACC
ATCGTTCGTCCGCGCCCTCCCACGCTCACGTCGATCCCTGCTTTGCTCGCCACTTTCCAGAACGAGTGGGATGCG
CTGGCTCTGGAAACCTACAATCTCAAGGAGCAGCTGGCTCGGACGCGAGAGGAGCTGGCGACGCTTCTCTACCAG
CAGGATGCCGCTGTCCGCGTCATTGTCCGCCTGACGAGGGAGAGGGACGAGGCTAGAGAGTCATTAAGCAAGGTC
ACCGTGGGAGGAGGCCCAGTAGGTGTGGAGGAAATGGTGGTCGACAGCGTCGAACCGCTTCCTGACGAGCTGGCT
GAGCGCGTCGACGAAACCCACAAGAGGTTCGCTCCTGTTGCCCGCACGCCGTCGCCGGCCGCGTCTGGCTCGAGT
ACCTCCGCTGACACCTTTTCCCTCCAACTAATCAGACTGACCAAGAGCCGGAAGAAGCGGCCGATACCCGAAGGC
TGGGCCTCTGCAGACGATATTTCTGCTTTGGAGACGGTCGCGTCCAGTTCCGTCTCGCTCTCGCACCCCACCTCT
CTCGACCTGCAGGAGGAACATGCCGCGCTGGGCGATTCCCAGGGTGAGGCCGTCATCTACTCGCTTCAGGCGGAA
GCGGTGGAGCGGCAGCTGTCCGTTGGCCAGCCCATAATGGACACGCTCTGGGCCGGGACAAAACTTGTCTTCGCC
ACGGGCCGAGGCGCTGTCAAAGTGTACGAAGGCGGCAAAGAGGCAACCTCCGCCTCGGACCATGCCGGTCCCGCC
ACGGCCCTGAGCACCCACCCCGGCGGCGAGATTCTAGCCTCCGTTGGGGCCGACAAAAGTATCGTCTTCTACGAC
CTGGGCTCTATGAAGCGCGTTGGACGCGTCTTCACTGATAGCTGTGGGTTCTCTTTCCACGTCCCCTCTTGCCAC
AGATGACGCGCTTACTGTTGTAGCTCTAAACAAGTGCGCCTTCCATCCCGACGGCCACCTCTTCGCCGCGGGCGC
CGTTTCGGGCGACATCAAGCTCTTCATGACCCAAACGCTCGAGCAGGCTGCCGCCTTCAGCCTCGGCGCGCCCAT
CGAGGCCCTCTCGTTCTCCGAGAACGGATTCTGGCTGGCGGCGACAGCCAAAGGGCAGAGCATCGTCACCATCTT
CGATCTACGGAAGGAGGGCGACGCGGCGATGGCCAAGGTGCTCGAGATTGGCGGCCCGGTGCAGTCGCTGGCCTG
GGACTTGACCGGGCAGTTCCTGGCGACGGGCGGCGCCGGCGGCGTGACGGTGCAGCACTACGCCAAGTCGAGCAA
GAAATGGAGCGAGCCTTTCCGGAACTCCGTGTCTGCCGTGGCCGTCCGATGGGGGCCGTCGGCTAGGAAGCTCAT
TGCTGTGGGCGACGACGGCGTCGTGGCGGTTTACAGGGTCAAGGAGGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail