Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4486
Gene name
Locationscaffold_356:11122..12175
Strand-
Gene length (bp)1053
Transcript length (bp)1053
Coding sequence length (bp)1050
Protein length (aa) 350

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01370 Epimerase NAD dependent epimerase/dehydratase family 1.2E-21 15 266
PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase 4.5E-12 17 132
PF13460 NAD_binding_10 NAD(P)H-binding 1.4E-10 19 146
PF07993 NAD_binding_4 Male sterility protein 4.2E-05 84 189
PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family 1.4E-09 16 143

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT59|YKJ7_SCHPO Putative uncharacterized oxidoreductase C513.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC513.07 PE=3 SV=1 15 344 3.0E-59
sp|Q12068|GRE2_YEAST NADPH-dependent methylglyoxal reductase GRE2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRE2 PE=1 SV=1 15 346 9.0E-55
sp|P53111|ARI1_YEAST NADPH-dependent aldehyde reductase ARI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARI1 PE=1 SV=1 15 349 8.0E-54
sp|Q03049|YD541_YEAST Putative uncharacterized oxidoreductase YDR541C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR541C PE=3 SV=2 15 343 3.0E-52
sp|P53183|YGD9_YEAST Putative uncharacterized oxidoreductase YGL039W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGL039W PE=1 SV=1 15 346 1.0E-51
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT59|YKJ7_SCHPO Putative uncharacterized oxidoreductase C513.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC513.07 PE=3 SV=1 15 344 3.0E-59
sp|Q12068|GRE2_YEAST NADPH-dependent methylglyoxal reductase GRE2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRE2 PE=1 SV=1 15 346 9.0E-55
sp|P53111|ARI1_YEAST NADPH-dependent aldehyde reductase ARI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARI1 PE=1 SV=1 15 349 8.0E-54
sp|Q03049|YD541_YEAST Putative uncharacterized oxidoreductase YDR541C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR541C PE=3 SV=2 15 343 3.0E-52
sp|P53183|YGD9_YEAST Putative uncharacterized oxidoreductase YGL039W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGL039W PE=1 SV=1 15 346 1.0E-51
sp|P83775|GRP2_CANAL Putative NADPH-dependent methylglyoxal reductase GRP2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GRP2 PE=1 SV=2 15 342 4.0E-48
sp|O94563|YGD4_SCHPO Putative uncharacterized oxidoreductase C1773.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.04 PE=1 SV=1 15 345 2.0E-35
sp|Q500U8|TKPR1_ARATH Tetraketide alpha-pyrone reductase 1 OS=Arabidopsis thaliana GN=TKPR1 PE=1 SV=1 10 341 2.0E-25
sp|P51102|DFRA_ARATH Dihydroflavonol-4-reductase OS=Arabidopsis thaliana GN=DFRA PE=1 SV=2 9 268 1.0E-24
sp|Q9XES5|DFRA_MALDO Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase OS=Malus domestica GN=DFR PE=1 SV=1 15 268 4.0E-24
sp|Q9UUN9|ALD2_SPOSA Aldehyde reductase 2 OS=Sporidiobolus salmonicolor PE=1 SV=3 15 339 7.0E-24
sp|Q84KP0|DFRA_PYRCO Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase OS=Pyrus communis GN=DFR PE=1 SV=1 15 268 8.0E-24
sp|Q9SEV0|BAN_ARATH Anthocyanidin reductase OS=Arabidopsis thaliana GN=BAN PE=1 SV=2 17 268 9.0E-24
sp|P14720|DFRA_PETHY Dihydroflavonol-4-reductase OS=Petunia hybrida GN=DFRA PE=2 SV=2 8 268 6.0E-23
sp|P51106|DFRA_HORVU Dihydroflavonol-4-reductase OS=Hordeum vulgare GN=ANT18 PE=3 SV=1 13 268 1.0E-22
sp|P51110|DFRA_VITVI Dihydroflavonol-4-reductase OS=Vitis vinifera GN=DFR PE=1 SV=1 15 268 1.0E-22
sp|P51105|DFRA_GERHY Dihydroflavonol-4-reductase OS=Gerbera hybrida GN=DFR PE=2 SV=1 12 268 3.0E-22
sp|Q9S9N9|CCR1_ARATH Cinnamoyl-CoA reductase 1 OS=Arabidopsis thaliana GN=CCR1 PE=1 SV=1 1 349 4.0E-21
sp|P51107|DFRA_SOLLC Dihydroflavonol-4-reductase OS=Solanum lycopersicum PE=2 SV=1 11 268 7.0E-20
sp|P51103|DFRA_CALCH Dihydroflavonol-4-reductase OS=Callistephus chinensis GN=F PE=2 SV=1 12 268 5.0E-19
sp|P51104|DFRA_DIACA Dihydroflavonol-4-reductase OS=Dianthus caryophyllus GN=A PE=2 SV=1 15 289 1.0E-18
sp|Q9SAH9|CCR2_ARATH Cinnamoyl-CoA reductase 2 OS=Arabidopsis thaliana GN=CCR2 PE=1 SV=1 15 347 5.0E-18
sp|P14721|DFRA_ANTMA Dihydroflavonol-4-reductase OS=Antirrhinum majus GN=DFRA PE=2 SV=1 11 268 1.0E-16
sp|O22133|BEN1_ARATH Protein BRI1-5 ENHANCED 1 OS=Arabidopsis thaliana GN=BEN1 PE=2 SV=1 15 268 2.0E-15
sp|P51109|DFRA_MEDSA Dihydroflavonol-4-reductase (Fragment) OS=Medicago sativa GN=DFR1 PE=2 SV=1 84 234 5.0E-15
sp|P51108|DFRA_MAIZE Dihydroflavonol-4-reductase OS=Zea mays GN=A1 PE=3 SV=1 15 268 7.0E-15
sp|Q9CA28|TKPR2_ARATH Tetraketide alpha-pyrone reductase 2 OS=Arabidopsis thaliana GN=TKPR2 PE=1 SV=1 16 300 8.0E-14
sp|Q40316|VESTR_MEDSA Vestitone reductase OS=Medicago sativa PE=1 SV=1 15 268 5.0E-13
sp|P73212|DFRA_SYNY3 Putative dihydroflavonol-4-reductase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dfrA PE=3 SV=1 17 339 8.0E-11
sp|A0R5C5|GALE_MYCS2 UDP-glucose 4-epimerase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_6142 PE=1 SV=2 15 212 7.0E-08
sp|P9WN67|GALE_MYCTU UDP-glucose 4-epimerase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=galE1 PE=1 SV=1 16 212 4.0E-07
sp|P9WN66|GALE_MYCTO UDP-glucose 4-epimerase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=galE1 PE=3 SV=1 16 212 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0006694 steroid biosynthetic process Yes
GO:0003854 3-beta-hydroxy-delta5-steroid dehydrogenase activity Yes
GO:1901360 organic cyclic compound metabolic process No
GO:0009058 biosynthetic process No
GO:0008150 biological_process No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0044238 primary metabolic process No
GO:0016491 oxidoreductase activity No
GO:0016229 steroid dehydrogenase activity No
GO:1901576 organic substance biosynthetic process No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0033764 steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0008202 steroid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006629 lipid metabolic process No
GO:0008610 lipid biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4486
MPSKVAKPVQPPAPVVVTGANGFIAQHCVAELLANGYRVVGTVRTESKAEEVRRLHGDGLIVVVVPDITDSVALT
ATLAEHEPAAVLHLAGPFHYQADDFERDLMRPAVGGAVAVLEAAAGLPTVQRVVYTSSFAGIYDASAGPRPGKTY
SARDWSPLTYGDGARAQDAPTAYRASKTVAERAAWAFIDARRPAFDLVSLCPAMVFGPLLSPPASVADLNTSNGV
VWSVLSAGRSRPVPPTRGPVWVDVRDVARAHLRALQVPEAAGRRFLLAAGVYCNQELADVGRRLCCRSKDADRIP
LGRPGQRESDRHFAVDASDAESVLGLRFRALENCLVDLVPQLFDIEHAAI
Coding >Ophio5|4486
ATGCCCTCGAAGGTGGCAAAGCCGGTTCAGCCGCCGGCTCCCGTCGTCGTGACGGGAGCCAACGGCTTCATCGCC
CAGCACTGCGTAGCAGAGCTATTAGCGAACGGCTACCGCGTCGTCGGCACTGTCCGGACGGAATCAAAAGCTGAG
GAGGTCCGACGTCTTCACGGAGACGGACTGATCGTCGTCGTTGTACCCGACATCACCGACTCGGTCGCTCTGACG
GCCACTCTGGCCGAACACGAACCCGCGGCGGTGTTGCATCTAGCCGGACCCTTTCACTACCAAGCCGACGACTTC
GAGCGCGATCTGATGCGGCCGGCCGTCGGGGGAGCTGTCGCCGTTCTCGAGGCGGCGGCCGGACTACCGACGGTT
CAGCGTGTCGTCTATACGAGCAGCTTCGCCGGCATCTACGACGCTTCCGCTGGTCCGAGGCCCGGCAAGACTTAC
TCGGCTAGAGATTGGAGTCCGCTGACGTACGGAGACGGGGCTCGTGCCCAGGACGCTCCCACCGCTTACCGGGCT
AGCAAGACGGTAGCCGAGAGAGCAGCCTGGGCCTTTATCGACGCCCGTCGTCCGGCTTTTGACCTCGTCAGCCTG
TGTCCGGCCATGGTCTTCGGACCTTTGCTTTCCCCCCCGGCTTCAGTAGCCGATCTAAACACCAGCAACGGCGTC
GTCTGGTCTGTTCTCTCCGCCGGACGGAGCCGTCCCGTTCCGCCGACGAGGGGCCCCGTCTGGGTCGACGTTCGA
GACGTGGCTCGCGCTCATCTTCGTGCCCTCCAAGTGCCCGAGGCGGCCGGTCGTCGCTTCCTGCTAGCTGCCGGC
GTTTACTGCAACCAGGAGCTGGCCGATGTCGGCCGTCGACTGTGTTGTCGCTCCAAAGACGCAGATCGAATCCCG
CTCGGTCGTCCGGGTCAGCGCGAGAGCGACCGACACTTTGCCGTCGATGCCTCTGACGCTGAGTCTGTCTTAGGT
CTGCGCTTTCGGGCTCTAGAGAACTGTCTGGTGGACCTGGTGCCGCAACTTTTTGACATTGAGCACGCCGCCATT
Transcript >Ophio5|4486
ATGCCCTCGAAGGTGGCAAAGCCGGTTCAGCCGCCGGCTCCCGTCGTCGTGACGGGAGCCAACGGCTTCATCGCC
CAGCACTGCGTAGCAGAGCTATTAGCGAACGGCTACCGCGTCGTCGGCACTGTCCGGACGGAATCAAAAGCTGAG
GAGGTCCGACGTCTTCACGGAGACGGACTGATCGTCGTCGTTGTACCCGACATCACCGACTCGGTCGCTCTGACG
GCCACTCTGGCCGAACACGAACCCGCGGCGGTGTTGCATCTAGCCGGACCCTTTCACTACCAAGCCGACGACTTC
GAGCGCGATCTGATGCGGCCGGCCGTCGGGGGAGCTGTCGCCGTTCTCGAGGCGGCGGCCGGACTACCGACGGTT
CAGCGTGTCGTCTATACGAGCAGCTTCGCCGGCATCTACGACGCTTCCGCTGGTCCGAGGCCCGGCAAGACTTAC
TCGGCTAGAGATTGGAGTCCGCTGACGTACGGAGACGGGGCTCGTGCCCAGGACGCTCCCACCGCTTACCGGGCT
AGCAAGACGGTAGCCGAGAGAGCAGCCTGGGCCTTTATCGACGCCCGTCGTCCGGCTTTTGACCTCGTCAGCCTG
TGTCCGGCCATGGTCTTCGGACCTTTGCTTTCCCCCCCGGCTTCAGTAGCCGATCTAAACACCAGCAACGGCGTC
GTCTGGTCTGTTCTCTCCGCCGGACGGAGCCGTCCCGTTCCGCCGACGAGGGGCCCCGTCTGGGTCGACGTTCGA
GACGTGGCTCGCGCTCATCTTCGTGCCCTCCAAGTGCCCGAGGCGGCCGGTCGTCGCTTCCTGCTAGCTGCCGGC
GTTTACTGCAACCAGGAGCTGGCCGATGTCGGCCGTCGACTGTGTTGTCGCTCCAAAGACGCAGATCGAATCCCG
CTCGGTCGTCCGGGTCAGCGCGAGAGCGACCGACACTTTGCCGTCGATGCCTCTGACGCTGAGTCTGTCTTAGGT
CTGCGCTTTCGGGCTCTAGAGAACTGTCTGGTGGACCTGGTGCCGCAACTTTTTGACATTGAGCACGCCGCCATT
TGA
Gene >Ophio5|4486
ATGCCCTCGAAGGTGGCAAAGCCGGTTCAGCCGCCGGCTCCCGTCGTCGTGACGGGAGCCAACGGCTTCATCGCC
CAGCACTGCGTAGCAGAGCTATTAGCGAACGGCTACCGCGTCGTCGGCACTGTCCGGACGGAATCAAAAGCTGAG
GAGGTCCGACGTCTTCACGGAGACGGACTGATCGTCGTCGTTGTACCCGACATCACCGACTCGGTCGCTCTGACG
GCCACTCTGGCCGAACACGAACCCGCGGCGGTGTTGCATCTAGCCGGACCCTTTCACTACCAAGCCGACGACTTC
GAGCGCGATCTGATGCGGCCGGCCGTCGGGGGAGCTGTCGCCGTTCTCGAGGCGGCGGCCGGACTACCGACGGTT
CAGCGTGTCGTCTATACGAGCAGCTTCGCCGGCATCTACGACGCTTCCGCTGGTCCGAGGCCCGGCAAGACTTAC
TCGGCTAGAGATTGGAGTCCGCTGACGTACGGAGACGGGGCTCGTGCCCAGGACGCTCCCACCGCTTACCGGGCT
AGCAAGACGGTAGCCGAGAGAGCAGCCTGGGCCTTTATCGACGCCCGTCGTCCGGCTTTTGACCTCGTCAGCCTG
TGTCCGGCCATGGTCTTCGGACCTTTGCTTTCCCCCCCGGCTTCAGTAGCCGATCTAAACACCAGCAACGGCGTC
GTCTGGTCTGTTCTCTCCGCCGGACGGAGCCGTCCCGTTCCGCCGACGAGGGGCCCCGTCTGGGTCGACGTTCGA
GACGTGGCTCGCGCTCATCTTCGTGCCCTCCAAGTGCCCGAGGCGGCCGGTCGTCGCTTCCTGCTAGCTGCCGGC
GTTTACTGCAACCAGGAGCTGGCCGATGTCGGCCGTCGACTGTGTTGTCGCTCCAAAGACGCAGATCGAATCCCG
CTCGGTCGTCCGGGTCAGCGCGAGAGCGACCGACACTTTGCCGTCGATGCCTCTGACGCTGAGTCTGTCTTAGGT
CTGCGCTTTCGGGCTCTAGAGAACTGTCTGGTGGACCTGGTGCCGCAACTTTTTGACATTGAGCACGCCGCCATT
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail