Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4468
Gene name
Locationscaffold_354:20820..21785
Strand+
Gene length (bp)965
Transcript length (bp)921
Coding sequence length (bp)918
Protein length (aa) 306

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08449 UAA UAA transporter family 4.3E-25 31 258

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5B5W2|HUT1_EMENI UDP-galactose transporter homolog 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hut1 PE=3 SV=1 16 302 3.0E-86
sp|Q4WJM7|HUT1_ASPFU UDP-galactose transporter homolog 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hut1 PE=3 SV=1 6 302 5.0E-76
sp|Q6C4X5|HUT1_YARLI UDP-galactose transporter homolog 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HUT1 PE=3 SV=1 14 302 2.0E-56
sp|Q5ADN8|HUT1_CANAL UDP-galactose transporter homolog 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HUT1 PE=3 SV=1 32 237 4.0E-41
sp|Q6BMV3|HUT1_DEBHA UDP-galactose transporter homolog 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HUT1 PE=3 SV=2 32 262 2.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5B5W2|HUT1_EMENI UDP-galactose transporter homolog 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hut1 PE=3 SV=1 16 302 3.0E-86
sp|Q4WJM7|HUT1_ASPFU UDP-galactose transporter homolog 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hut1 PE=3 SV=1 6 302 5.0E-76
sp|Q6C4X5|HUT1_YARLI UDP-galactose transporter homolog 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HUT1 PE=3 SV=1 14 302 2.0E-56
sp|Q5ADN8|HUT1_CANAL UDP-galactose transporter homolog 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HUT1 PE=3 SV=1 32 237 4.0E-41
sp|Q6BMV3|HUT1_DEBHA UDP-galactose transporter homolog 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HUT1 PE=3 SV=2 32 262 2.0E-35
sp|Q4P9R2|HUT1_USTMA UDP-galactose transporter homolog 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HUT1 PE=3 SV=2 29 302 3.0E-35
sp|Q8WZJ9|HUT1_SCHPO UDP-galactose transporter homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hut1 PE=3 SV=1 29 302 1.0E-34
sp|Q12520|HUT1_YEAST UDP-galactose transporter homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HUT1 PE=1 SV=1 32 264 7.0E-31
sp|Q755H7|HUT1_ASHGO UDP-galactose transporter homolog 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HUT1 PE=3 SV=2 31 264 8.0E-28
sp|P0CP32|HUT1_CRYNJ UDP-galactose transporter homolog 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HUT1-A PE=3 SV=1 31 248 2.0E-27
sp|P0CP33|HUT1_CRYNB UDP-galactose transporter homolog 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HUT1-A PE=3 SV=1 31 248 2.0E-27
sp|Q6FSF8|HUT1_CANGA UDP-galactose transporter homolog 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HUT1 PE=3 SV=1 37 306 3.0E-27
sp|Q6CR04|HUT1_KLULA UDP-galactose transporter homolog 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HUT1 PE=3 SV=1 35 264 2.0E-25
sp|Q54I86|S35B1_DICDI Solute carrier family 35 member B1 OS=Dictyostelium discoideum GN=slc35b1 PE=3 SV=2 4 302 5.0E-21
sp|Q6NMB6|UTR5B_ARATH UDP-galactose/UDP-glucose transporter 5B OS=Arabidopsis thaliana GN=At5g59740 PE=2 SV=1 25 271 2.0E-18
sp|Q6GQ70|S35B1_XENLA Solute carrier family 35 member B1 OS=Xenopus laevis GN=slc35b1 PE=2 SV=1 31 302 5.0E-18
sp|Q8AXS6|S35B1_XENTR Solute carrier family 35 member B1 OS=Xenopus tropicalis GN=slc35b1 PE=2 SV=2 31 302 2.0E-17
sp|P97858|S35B1_MOUSE Solute carrier family 35 member B1 OS=Mus musculus GN=Slc35b1 PE=1 SV=1 27 302 9.0E-17
sp|Q9VEI3|S35B2_DROME Adenosine 3'-phospho 5'-phosphosulfate transporter 1 OS=Drosophila melanogaster GN=sll PE=1 SV=1 11 300 2.0E-15
sp|Q91ZN5|S35B2_MOUSE Adenosine 3'-phospho 5'-phosphosulfate transporter 1 OS=Mus musculus GN=Slc35b2 PE=1 SV=1 28 269 3.0E-15
sp|Q8AWB6|S35B1_CHICK Solute carrier family 35 member B1 OS=Gallus gallus GN=SLC35B1 PE=2 SV=1 23 302 1.0E-14
sp|O64503|UTR1_ARATH UDP-galactose/UDP-glucose transporter 1 OS=Arabidopsis thaliana GN=UTR1 PE=1 SV=1 32 277 1.0E-14
sp|Q6V7K3|S35B1_RAT Solute carrier family 35 member B1 OS=Rattus norvegicus GN=Slc35b1 PE=2 SV=1 27 302 7.0E-14
sp|Q8MII5|S35B1_BOVIN Solute carrier family 35 member B1 OS=Bos taurus GN=SLC35B1 PE=2 SV=2 27 302 9.0E-14
sp|Q8TB61|S35B2_HUMAN Adenosine 3'-phospho 5'-phosphosulfate transporter 1 OS=Homo sapiens GN=SLC35B2 PE=1 SV=1 5 269 1.0E-13
sp|P78383|S35B1_HUMAN Solute carrier family 35 member B1 OS=Homo sapiens GN=SLC35B1 PE=1 SV=1 27 226 2.0E-13
sp|Q55DM5|S35B2_DICDI Adenosine 3'-phospho 5'-phosphosulfate transporter 1 OS=Dictyostelium discoideum GN=slc35b2 PE=3 SV=1 9 302 3.0E-13
sp|Q9M9S6|UTR3_ARATH UDP-galactose/UDP-glucose transporter 3 OS=Arabidopsis thaliana GN=UTR3 PE=1 SV=1 32 267 3.0E-13
sp|Q5R9A1|S35B2_PONAB Adenosine 3'-phospho 5'-phosphosulfate transporter 1 OS=Pongo abelii GN=SLC35B2 PE=2 SV=2 5 269 4.0E-13
sp|Q6NM25|UTR5_ARATH UDP-galactose/UDP-glucose transporter 5 OS=Arabidopsis thaliana GN=UTR5 PE=2 SV=1 35 305 4.0E-13
sp|Q66HX0|S35B1_DANRE Solute carrier family 35 member B1 OS=Danio rerio GN=slc35b1 PE=2 SV=1 21 302 2.0E-12
sp|Q9VDD7|S35B1_DROME Solute carrier family 35 member B1 homolog OS=Drosophila melanogaster GN=meigo PE=2 SV=1 27 301 2.0E-09
sp|Q17CE7|S35B3_AEDAE Adenosine 3'-phospho 5'-phosphosulfate transporter 2 OS=Aedes aegypti GN=Papst2 PE=3 SV=1 9 246 4.0E-07
sp|Q922Q5|S35B3_MOUSE Adenosine 3'-phospho 5'-phosphosulfate transporter 2 OS=Mus musculus GN=Slc35b3 PE=2 SV=1 28 187 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0051179 localization No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 32 49 17
2 69 88 19
3 101 123 22
4 133 155 22
5 162 181 19
6 209 231 22
7 252 274 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4468
MARIKQQKQQDQRPLTDDGPSPQQQQPQLHQLAIAVAGIYGTFLTWAYLQEKLTTTGYGPQHERWRFPVVLNTVQ
SVLAAVVGAGYLVATTARGDRVPSVIASRAMLTPLVVVAVTSSLASPFGYASLAHLDYVTFLLAKSCKLVPVMAL
HVTLFRRRYPRYKYLVVGAVTLGVAVFTLYSSSSSGNKSRRLRRRLQTGDDEDAASSSSSMAWGMLLLAVNLLFD
GLTNTTQDYIFRAFRPYSGPQMMCANNIISSLLTGAYLVAGPFLALLPVGAWLGVDDAAAGGELSAALAFVARHP
SVCLYL
Coding >Ophio5|4468
ATGGCGAGGATCAAGCAGCAAAAACAACAAGATCAACGACCACTCACCGATGACGGGCCATCACCACAACAGCAG
CAGCCGCAGCTACACCAACTGGCCATCGCGGTCGCGGGCATCTACGGCACGTTCCTAACATGGGCGTACCTGCAA
GAGAAGCTGACGACGACGGGATACGGGCCGCAACACGAACGATGGCGGTTTCCCGTCGTTCTGAACACGGTGCAA
TCGGTTCTCGCCGCCGTCGTGGGAGCGGGCTACCTTGTAGCGACGACGGCTCGAGGCGATAGGGTGCCGTCGGTG
ATAGCGAGCCGGGCGATGCTGACGCCTCTGGTGGTGGTGGCGGTGACGAGCAGTCTAGCGAGTCCGTTTGGCTAT
GCGAGTCTGGCCCATCTCGACTATGTGACTTTCCTACTGGCCAAGAGCTGCAAGCTGGTGCCCGTCATGGCGTTG
CACGTTACGCTCTTCCGGAGACGATATCCGCGGTATAAATACCTCGTTGTCGGGGCCGTTACCCTGGGCGTTGCC
GTCTTCACCCTTTATTCTTCCTCATCGTCTGGCAACAAGAGTCGTCGTCTTCGTCGTCGCCTTCAGACGGGTGAT
GATGAGGATGCCGCTTCTTCTTCTTCTTCCATGGCCTGGGGCATGCTTCTTCTCGCCGTCAACCTTCTCTTCGAT
GGCCTTACCAACACGACGCAGGACTACATCTTTCGCGCCTTTCGTCCTTACTCGGGTCCGCAGATGATGTGCGCG
AATAACATCATCAGCTCTCTCCTTACCGGTGCATACCTCGTCGCGGGGCCCTTTCTCGCCCTCTTGCCTGTCGGC
GCTTGGCTTGGTGTCGATGATGCCGCGGCCGGCGGGGAGCTGAGCGCTGCTCTGGCTTTCGTTGCGCGACATCCT
TCCGTCTGTCTTTATCTG
Transcript >Ophio5|4468
ATGGCGAGGATCAAGCAGCAAAAACAACAAGATCAACGACCACTCACCGATGACGGGCCATCACCACAACAGCAG
CAGCCGCAGCTACACCAACTGGCCATCGCGGTCGCGGGCATCTACGGCACGTTCCTAACATGGGCGTACCTGCAA
GAGAAGCTGACGACGACGGGATACGGGCCGCAACACGAACGATGGCGGTTTCCCGTCGTTCTGAACACGGTGCAA
TCGGTTCTCGCCGCCGTCGTGGGAGCGGGCTACCTTGTAGCGACGACGGCTCGAGGCGATAGGGTGCCGTCGGTG
ATAGCGAGCCGGGCGATGCTGACGCCTCTGGTGGTGGTGGCGGTGACGAGCAGTCTAGCGAGTCCGTTTGGCTAT
GCGAGTCTGGCCCATCTCGACTATGTGACTTTCCTACTGGCCAAGAGCTGCAAGCTGGTGCCCGTCATGGCGTTG
CACGTTACGCTCTTCCGGAGACGATATCCGCGGTATAAATACCTCGTTGTCGGGGCCGTTACCCTGGGCGTTGCC
GTCTTCACCCTTTATTCTTCCTCATCGTCTGGCAACAAGAGTCGTCGTCTTCGTCGTCGCCTTCAGACGGGTGAT
GATGAGGATGCCGCTTCTTCTTCTTCTTCCATGGCCTGGGGCATGCTTCTTCTCGCCGTCAACCTTCTCTTCGAT
GGCCTTACCAACACGACGCAGGACTACATCTTTCGCGCCTTTCGTCCTTACTCGGGTCCGCAGATGATGTGCGCG
AATAACATCATCAGCTCTCTCCTTACCGGTGCATACCTCGTCGCGGGGCCCTTTCTCGCCCTCTTGCCTGTCGGC
GCTTGGCTTGGTGTCGATGATGCCGCGGCCGGCGGGGAGCTGAGCGCTGCTCTGGCTTTCGTTGCGCGACATCCT
TCCGTCTGTCTTTATCTGTGA
Gene >Ophio5|4468
ATGGCGAGGATCAAGCAGCAAAAACAACAAGATCAACGACCACTCACCGATGACGGGCCATCACCACAACAGCAG
CAGCCGCAGCTACACCAACTGGCCATCGCGGTCGCGGGCATCTACGGCACGTTCCTAACATGGGCGTACCTGCAA
GAGAAGCTGACGACGACGGGATACGGGCCGCAACACGAACGATGGCGGTTTCCCGTCGTTCTGAACACGGTGCAA
TCGGTTCTCGCCGCCGTCGTGGGAGCGGGCTACCTTGTAGCGACGACGGCTCGAGGCGATAGGGTGCCGTCGGTG
ATAGCGAGCCGGGCGATGCTGACGCCTCTGGTGGTGGTGGCGGTGACGAGCAGTCTAGCGAGTCCGTTTGGCTAT
GCGAGTCTGGCCCATCTCGACTATGTGACTTTCCTACTGGCCAAGAGCTGCAAGCTGGTGCCCGTCATGGCGTTG
CACGTTACGCTCTTCCGGAGACGATATCCGCGGTATAAATACCTCGTTGTCGGGGCCGTTACCCTGGGCGTTGCC
GTCTTCACCCTTTATTCTTCCTCATCGTCTGGCAACAAGAGTCGTCGTCTTCGTCGTCGCCTTCAGACGGGTGAT
GATGAGGATGCCGCTTCTTCTTCTTCTTCCATGGCCTGGGGCATGCTTCTTCTCGCCGTCAACCTTCTCTTCGAT
GGCCTTACCAACACGACGCAGGACTACATCTTTCGCGCCTTTCGTCCTTACTCGGGTCCGCAGATGATGTGCGCG
AATAACATCATCAGCTCTCTCCTTACCGGTGCATACCTCGTCGCGGGGCCCTTTCTCGCCCTCTTGCCTGTCGGC
GCTTGGCTTGGTGTCGATGATGCCGCGGCCGGCGGGGAGCTGAGCGCTGCTCTGGCTTTCGTTGCGCGACATCCT
TCCGTCTGTAAGGATGTCCTCGGCTTTGCCATCTGTGGTGCCGTCGGACAGGTCTTTATCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail