Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4464
Gene name
Locationscaffold_354:11587..14056
Strand-
Gene length (bp)2469
Transcript length (bp)2088
Coding sequence length (bp)2085
Protein length (aa) 695

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00566 RabGAP-TBC Rab-GTPase-TBC domain 2.9E-13 217 295

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q92609|TBCD5_HUMAN TBC1 domain family member 5 OS=Homo sapiens GN=TBC1D5 PE=1 SV=1 42 310 7.0E-29
sp|Q80XQ2|TBCD5_MOUSE TBC1 domain family member 5 OS=Mus musculus GN=Tbc1d5 PE=1 SV=2 42 310 5.0E-27
sp|Q54TA5|TBC5B_DICDI TBC1 domain family member 5 homolog B OS=Dictyostelium discoideum GN=tbc1d5B PE=3 SV=1 202 310 8.0E-23
sp|Q9NVG8|TBC13_HUMAN TBC1 domain family member 13 OS=Homo sapiens GN=TBC1D13 PE=1 SV=3 227 310 1.0E-13
sp|Q54VM3|TBC5A_DICDI TBC1 domain family member 5 homolog A OS=Dictyostelium discoideum GN=tbc1d5A PE=1 SV=1 223 314 4.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q92609|TBCD5_HUMAN TBC1 domain family member 5 OS=Homo sapiens GN=TBC1D5 PE=1 SV=1 42 310 7.0E-29
sp|Q80XQ2|TBCD5_MOUSE TBC1 domain family member 5 OS=Mus musculus GN=Tbc1d5 PE=1 SV=2 42 310 5.0E-27
sp|Q54TA5|TBC5B_DICDI TBC1 domain family member 5 homolog B OS=Dictyostelium discoideum GN=tbc1d5B PE=3 SV=1 202 310 8.0E-23
sp|Q9NVG8|TBC13_HUMAN TBC1 domain family member 13 OS=Homo sapiens GN=TBC1D13 PE=1 SV=3 227 310 1.0E-13
sp|Q54VM3|TBC5A_DICDI TBC1 domain family member 5 homolog A OS=Dictyostelium discoideum GN=tbc1d5A PE=1 SV=1 223 314 4.0E-13
sp|Q8R3D1|TBC13_MOUSE TBC1 domain family member 13 OS=Mus musculus GN=Tbc1d13 PE=1 SV=1 227 310 2.0E-12
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 61 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4464
MRPLEETLSRWKLTVDCGDSLADLQRAVRNNGSASPCLAGCRSVCWKTFILSTRAGLNQALEDGRREYGQRRSHF
LNFIEHPEALAQLAIDPLTDDPESPWNTLRHDETIRNEIQQDVQRLPDEVNYHQDRVQAMIVNILFVYCKVYPSR
GGACGGAGRHQPDRSCSRRSVFGRVHARGPRFVVFYELRDAGSPSRPSQAADAASEQLSTIVDKSRFIHEVCLCS
VDEELATHLVNMEVLPQIFLIRWIRLLFSREFPFDQVLFMWDTIFAVDPSLHLIDFICCAMLLRIRWQLLEADYA
VCLQLLLKYPQPLPPHGPHTFIDDAIYLQAHADASGGNALIKKYSGRTPDASSPSNRARTRTPGRQGSGSPRRRT
YGGRSPLTSPTRFIQHQGGVESIFHGAAKSAKGVLERGEKFGLNSAVREAVGEIRRNVQIFNESRQILKSPKGTL
DDGAAAGALAAMERRNKQLAALLEETVASLKSISLSSLEDKSKSLDVIELAAAKVQFVQLYLGDSSMEMPPAETS
DEPEGEAKSEPGDDVSKGEDSTDRAATGPSQSAKDVELDEPRLDVAGVDQADTTRHSKQEASDADEAVRDDSARA
GEPTRPAAPIPTRSTLAQSSFSWMLEPDAPSRSPSVPSTSRHGTIQHRKRPSSNASRDRNAFLFGEGMADGERGP
SSQGDEIFGLEPISRAKDKT
Coding >Ophio5|4464
ATGAGACCTCTGGAGGAGACGCTGTCGAGATGGAAACTAACCGTCGATTGCGGCGACAGCCTCGCCGACTTACAG
CGCGCCGTCAGGAATAATGGTTCCGCAAGTCCGTGTCTCGCTGGATGCCGCTCCGTGTGCTGGAAGACGTTCATC
TTGTCTACTCGCGCGGGCCTGAACCAGGCTCTCGAAGACGGCAGACGGGAATACGGCCAGCGCAGAAGCCACTTT
CTCAACTTCATCGAGCATCCAGAGGCCCTGGCCCAGCTCGCAATCGACCCGCTGACCGACGACCCTGAGTCTCCC
TGGAACACACTGCGCCATGACGAGACGATCCGCAACGAGATCCAACAGGACGTTCAGCGGCTTCCTGACGAGGTC
AATTACCACCAAGACCGGGTGCAGGCCATGATTGTCAACATCCTCTTTGTCTACTGCAAGGTTTACCCGAGCAGA
GGCGGTGCATGTGGTGGAGCAGGACGCCATCAACCGGACCGCAGCTGCAGCCGGCGCAGCGTCTTTGGACGAGTC
CATGCTCGTGGTCCTCGATTCGTCGTGTTTTACGAGCTGAGAGACGCAGGATCTCCGTCGAGACCGTCTCAGGCA
GCTGATGCCGCCTCTGAACAACTGTCGACCATTGTCGACAAGAGCAGGTTCATCCACGAGGTCTGCCTGTGCAGT
GTGGACGAAGAGCTAGCCACGCATCTCGTGAATATGGAGGTGCTGCCGCAGATTTTCCTCATCCGATGGATACGA
CTGCTCTTCAGTCGAGAATTCCCCTTCGACCAAGTCCTCTTTATGTGGGACACCATTTTTGCCGTCGATCCTTCT
CTTCATTTAATAGATTTTATTTGTTGTGCCATGCTGCTCCGCATTCGATGGCAATTGCTTGAAGCCGACTATGCT
GTCTGTCTTCAACTTCTCTTAAAGTACCCTCAACCGCTACCGCCACATGGACCACACACTTTTATCGATGACGCC
ATCTATCTCCAGGCCCATGCGGATGCGTCAGGGGGTAATGCTCTCATCAAGAAATACAGCGGCAGAACACCAGAT
GCCTCAAGCCCGTCAAATCGCGCTCGAACGAGAACACCGGGTCGTCAAGGGTCGGGATCTCCTCGACGGAGAACA
TACGGCGGAAGGTCGCCGCTCACTTCACCAACACGTTTCATTCAGCATCAAGGCGGCGTGGAATCCATATTTCAT
GGCGCGGCCAAGAGCGCCAAGGGGGTCTTGGAACGAGGAGAAAAGTTTGGCCTTAACAGTGCAGTGCGGGAGGCC
GTGGGAGAGATTAGGCGGAATGTGCAGATTTTCAACGAGTCCCGACAGATACTCAAGTCGCCAAAGGGCACCCTC
GACGACGGCGCCGCAGCAGGAGCTCTCGCCGCCATGGAGAGGCGTAATAAGCAACTGGCAGCACTCCTGGAAGAG
ACGGTCGCGAGTCTCAAATCAATTTCCCTGTCGAGCCTTGAGGACAAGAGCAAGAGCCTGGACGTAATCGAGCTC
GCGGCAGCCAAGGTTCAATTCGTCCAGTTATATCTCGGTGATTCGTCCATGGAGATGCCACCCGCCGAGACATCA
GACGAGCCTGAAGGCGAGGCCAAGAGTGAGCCCGGAGACGACGTCTCGAAAGGGGAAGACTCCACCGATAGGGCT
GCGACTGGGCCGAGTCAATCAGCCAAGGATGTCGAGCTCGACGAGCCCAGACTGGATGTTGCAGGCGTGGACCAA
GCAGACACGACTCGGCACTCGAAACAAGAAGCTTCAGACGCCGACGAGGCAGTAAGGGACGACTCGGCTCGTGCC
GGCGAGCCCACTCGTCCCGCCGCGCCGATCCCTACGCGCTCGACACTCGCACAGTCGTCATTTTCGTGGATGCTG
GAGCCCGACGCACCGAGCCGCAGCCCGAGCGTACCGTCGACCAGCAGACATGGCACCATACAGCACAGGAAGCGG
CCCTCGAGCAACGCCAGCCGAGACAGGAACGCGTTCCTGTTTGGTGAGGGCATGGCAGACGGTGAGAGGGGGCCG
TCGTCCCAGGGTGATGAGATTTTTGGGCTGGAGCCTATCAGCAGGGCTAAAGACAAGACG
Transcript >Ophio5|4464
ATGAGACCTCTGGAGGAGACGCTGTCGAGATGGAAACTAACCGTCGATTGCGGCGACAGCCTCGCCGACTTACAG
CGCGCCGTCAGGAATAATGGTTCCGCAAGTCCGTGTCTCGCTGGATGCCGCTCCGTGTGCTGGAAGACGTTCATC
TTGTCTACTCGCGCGGGCCTGAACCAGGCTCTCGAAGACGGCAGACGGGAATACGGCCAGCGCAGAAGCCACTTT
CTCAACTTCATCGAGCATCCAGAGGCCCTGGCCCAGCTCGCAATCGACCCGCTGACCGACGACCCTGAGTCTCCC
TGGAACACACTGCGCCATGACGAGACGATCCGCAACGAGATCCAACAGGACGTTCAGCGGCTTCCTGACGAGGTC
AATTACCACCAAGACCGGGTGCAGGCCATGATTGTCAACATCCTCTTTGTCTACTGCAAGGTTTACCCGAGCAGA
GGCGGTGCATGTGGTGGAGCAGGACGCCATCAACCGGACCGCAGCTGCAGCCGGCGCAGCGTCTTTGGACGAGTC
CATGCTCGTGGTCCTCGATTCGTCGTGTTTTACGAGCTGAGAGACGCAGGATCTCCGTCGAGACCGTCTCAGGCA
GCTGATGCCGCCTCTGAACAACTGTCGACCATTGTCGACAAGAGCAGGTTCATCCACGAGGTCTGCCTGTGCAGT
GTGGACGAAGAGCTAGCCACGCATCTCGTGAATATGGAGGTGCTGCCGCAGATTTTCCTCATCCGATGGATACGA
CTGCTCTTCAGTCGAGAATTCCCCTTCGACCAAGTCCTCTTTATGTGGGACACCATTTTTGCCGTCGATCCTTCT
CTTCATTTAATAGATTTTATTTGTTGTGCCATGCTGCTCCGCATTCGATGGCAATTGCTTGAAGCCGACTATGCT
GTCTGTCTTCAACTTCTCTTAAAGTACCCTCAACCGCTACCGCCACATGGACCACACACTTTTATCGATGACGCC
ATCTATCTCCAGGCCCATGCGGATGCGTCAGGGGGTAATGCTCTCATCAAGAAATACAGCGGCAGAACACCAGAT
GCCTCAAGCCCGTCAAATCGCGCTCGAACGAGAACACCGGGTCGTCAAGGGTCGGGATCTCCTCGACGGAGAACA
TACGGCGGAAGGTCGCCGCTCACTTCACCAACACGTTTCATTCAGCATCAAGGCGGCGTGGAATCCATATTTCAT
GGCGCGGCCAAGAGCGCCAAGGGGGTCTTGGAACGAGGAGAAAAGTTTGGCCTTAACAGTGCAGTGCGGGAGGCC
GTGGGAGAGATTAGGCGGAATGTGCAGATTTTCAACGAGTCCCGACAGATACTCAAGTCGCCAAAGGGCACCCTC
GACGACGGCGCCGCAGCAGGAGCTCTCGCCGCCATGGAGAGGCGTAATAAGCAACTGGCAGCACTCCTGGAAGAG
ACGGTCGCGAGTCTCAAATCAATTTCCCTGTCGAGCCTTGAGGACAAGAGCAAGAGCCTGGACGTAATCGAGCTC
GCGGCAGCCAAGGTTCAATTCGTCCAGTTATATCTCGGTGATTCGTCCATGGAGATGCCACCCGCCGAGACATCA
GACGAGCCTGAAGGCGAGGCCAAGAGTGAGCCCGGAGACGACGTCTCGAAAGGGGAAGACTCCACCGATAGGGCT
GCGACTGGGCCGAGTCAATCAGCCAAGGATGTCGAGCTCGACGAGCCCAGACTGGATGTTGCAGGCGTGGACCAA
GCAGACACGACTCGGCACTCGAAACAAGAAGCTTCAGACGCCGACGAGGCAGTAAGGGACGACTCGGCTCGTGCC
GGCGAGCCCACTCGTCCCGCCGCGCCGATCCCTACGCGCTCGACACTCGCACAGTCGTCATTTTCGTGGATGCTG
GAGCCCGACGCACCGAGCCGCAGCCCGAGCGTACCGTCGACCAGCAGACATGGCACCATACAGCACAGGAAGCGG
CCCTCGAGCAACGCCAGCCGAGACAGGAACGCGTTCCTGTTTGGTGAGGGCATGGCAGACGGTGAGAGGGGGCCG
TCGTCCCAGGGTGATGAGATTTTTGGGCTGGAGCCTATCAGCAGGGCTAAAGACAAGACGTGA
Gene >Ophio5|4464
ATGAGACCTCTGGAGGAGACGCTGTGAGTCGCCGTGTGCCCGGCCGTGGCTCGTGAGGAGGCGGGTGAGGCTGAC
GCGACTTCGTATCCAGGTCGAGATGGAAACTAACCGTCGATTGCGGCGACAGCCTCGCCGACTTACAGCGCGCCG
TCAGGAATAATGGTTCCGCAAGTCCGTGTCTCGCTGGATGCCGCTCCGTGTGCTGGAAGGTGTGTCGGCCCCAGG
CTCGCGTCCTCGTGCCTGGCCGTTGACCACCCGCTCTCGTTCCGCCTTACAAGACGTTCATCTTGTCTACTCGCG
CGGGCCTGAACCAGGCTCTCGAAGACGGCAGACGGGAATACGGCCAGCGCAGAAGCCACTTTCTCAACTTCATCG
AGCATCCAGAGGCCCTGGCCCAGCTCGCAATCGACCCGCTGACCGACGACCCTGAGGTGAGCCGAGGCCGACGAC
GGCCCGACGTCTCACTAACAGCGTTGGCAGTCTCCCTGGAACACACTGCGCCATGACGAGACGATCCGCAACGAG
ATCCAACAGGACGTTCAGCGGCTTCCTGACGAGGTCAATTACCACCAAGACCGGGTGCAGGCCATGATTGTCAAC
ATCCTCTTTGTCTACTGCAAGGTTTACCCGAGCAGAGGCGGGTATCGCCAGGGAATGCACGAACTGTTGGCTCCC
ATAGTGCATGTGGTGGAGCAGGACGCCATCAACCGGACCGCAGCTGCAGCCGGCGCAGCGTCTTTGGACGAGTCC
ATGCTCGTGGTCCTCGATTCGTCGTACGTCGAGCACGATGCTTACATACTGTTTTCGCGGCTCATGGAGCACGCC
CAGGTGTTTTACGAGCTGAGAGACGCAGGATCTCCGTCGAGACCGTCTCAGGCAGCTGATGCCGCCTCTGAACAA
CTGTCGACCATTGTCGACAAGAGCAGGTTCATCCACGAGGTCTGCCTGTGCAGTGTGGACGAAGAGCTAGCCACG
CATCTCGTGAATATGGAGGTGCTGCCGCAGATTTTCCTCATGTAAGTGAAGTTGCCGGCTTGACTGCTTTGAATG
TCACTAAGCCACGACGCAGCCGATGGATACGACTGCTCTTCAGTCGAGAATTCCCCTTCGACCAAGTCCTCTTTA
TGTGGGACACCATTTTTGCCGTCGATCCTTCTCTTCATTTAATAGATTTTATTTGTTGTGCCATGCTGCTCCGCA
TTCGATGGCAATGTGAGTTGAGAAGACGCCACAACAGCTTTTCTATCTGACTCCATTGCAGTGCTTGAAGCCGAC
TATGCTGTCTGTCTTCAACTTCTCTTAAAGTACCCTCAACCGCTACCGCCACATGGACCACACACTTTTATCGAT
GACGCCATCTATCTCCAGGCCCATGCGGATGCGTCAGGGGGTAATGCTCTCATCAAGAAATACAGCGGCAGAACA
CCAGATGCCTCAAGCCCGTCAAATCGCGCTCGAACGAGAACACCGGGTCGTCAAGGGTCGGGATCTCCTCGACGG
AGAACATACGGCGGAAGGTCGCCGCTCACTTCACCAACACGTTTCATTCAGCATCAAGGCGGCGTGGAATCCATA
TTTCATGGCGCGGCCAAGAGCGCCAAGGGGGTCTTGGAACGAGGAGAAAAGTTTGGCCTTAACAGTGCAGTGCGG
GAGGCCGTGGGAGAGATTAGGCGGAATGTGCAGATTTTCAACGAGTCCCGACAGATACTCAAGTCGCCAAAGGGC
ACCCTCGACGACGGCGCCGCAGCAGGAGCTCTCGCCGCCATGGAGAGGCGTAATAAGCAACTGGCAGCACTCCTG
GAAGAGACGGTCGCGAGTCTCAAATCAATTTCCCTGTCGAGCCTTGAGGACAAGAGCAAGAGCCTGGACGTAATC
GAGCTCGCGGCAGCCAAGGTTCAATTCGTCCAGTTATATCTCGGTGATTCGTCCATGGAGATGCCACCCGCCGAG
ACATCAGACGAGCCTGAAGGCGAGGCCAAGAGTGAGCCCGGAGACGACGTCTCGAAAGGGGAAGACTCCACCGAT
AGGGCTGCGACTGGGCCGAGTCAATCAGCCAAGGATGTCGAGCTCGACGAGCCCAGACTGGATGTTGCAGGCGTG
GACCAAGCAGACACGACTCGGCACTCGAAACAAGAAGCTTCAGACGCCGACGAGGCAGTAAGGGACGACTCGGCT
CGTGCCGGCGAGCCCACTCGTCCCGCCGCGCCGATCCCTACGCGCTCGACACTCGCACAGTCGTCATTTTCGTGG
ATGCTGGAGCCCGACGCACCGAGCCGCAGCCCGAGCGTACCGTCGACCAGCAGACATGGCACCATACAGCACAGG
AAGCGGCCCTCGAGCAACGCCAGCCGAGACAGGAACGCGTTCCTGTTTGGTGAGGGCATGGCAGACGGTGAGAGG
GGGCCGTCGTCCCAGGGTGATGAGATTTTTGGGCTGGAGCCTATCAGCAGGGCTAAAGACAAGACGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail