Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4459
Gene name
Locationscaffold_353:14333..15950
Strand+
Gene length (bp)1617
Transcript length (bp)1077
Coding sequence length (bp)1074
Protein length (aa) 358

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00120 Gln-synt_C Glutamine synthetase, catalytic domain 9.0E-11 171 258
PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain 1.7E-12 27 102

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C2U9|GLNA_GIBFU Glutamine synthetase OS=Gibberella fujikuroi GN=GLN1 PE=3 SV=1 7 351 0.0E+00
sp|Q9UUN6|GLNA_FUSSH Glutamine synthetase OS=Fusarium solani subsp. phaseoli GN=GLN1 PE=2 SV=1 1 351 0.0E+00
sp|Q86ZF9|GLNA_NEUCR Glutamine synthetase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gln-1 PE=3 SV=1 1 356 0.0E+00
sp|Q12613|GLNA_COLGL Glutamine synthetase OS=Colletotrichum gloeosporioides GN=GLN1 PE=3 SV=1 1 356 0.0E+00
sp|Q86ZU6|GLNA_TUBBO Glutamine synthetase OS=Tuber borchii GN=GLN1 PE=2 SV=1 1 356 3.0E-180
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C2U9|GLNA_GIBFU Glutamine synthetase OS=Gibberella fujikuroi GN=GLN1 PE=3 SV=1 7 351 0.0E+00
sp|Q9UUN6|GLNA_FUSSH Glutamine synthetase OS=Fusarium solani subsp. phaseoli GN=GLN1 PE=2 SV=1 1 351 0.0E+00
sp|Q86ZF9|GLNA_NEUCR Glutamine synthetase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gln-1 PE=3 SV=1 1 356 0.0E+00
sp|Q12613|GLNA_COLGL Glutamine synthetase OS=Colletotrichum gloeosporioides GN=GLN1 PE=3 SV=1 1 356 0.0E+00
sp|Q86ZU6|GLNA_TUBBO Glutamine synthetase OS=Tuber borchii GN=GLN1 PE=2 SV=1 1 356 3.0E-180
sp|Q96V52|GLNA_EMENI Glutamine synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=glnA PE=3 SV=3 9 356 9.0E-176
sp|Q6B4U7|GLNA_DEBHA Glutamine synthetase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GLN1 PE=3 SV=1 7 356 1.0E-174
sp|Q75BT9|GLNA_ASHGO Glutamine synthetase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GLN1 PE=3 SV=1 7 356 2.0E-172
sp|Q6C3E0|GLNA_YARLI Glutamine synthetase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GLN1 PE=3 SV=1 13 356 4.0E-172
sp|Q874T6|GLNA_KLULA Glutamine synthetase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GLN1 PE=3 SV=1 1 356 1.0E-171
sp|P32288|GLNA_YEAST Glutamine synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLN1 PE=1 SV=4 5 356 2.0E-169
sp|Q6FMT6|GLNA_CANGA Glutamine synthetase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GLN1 PE=3 SV=1 10 356 3.0E-168
sp|P0CN84|GLNA_CRYNJ Glutamine synthetase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=GLN1 PE=2 SV=1 3 353 2.0E-167
sp|P0CN85|GLNA_CRYNB Glutamine synthetase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=GLN1 PE=3 SV=1 3 353 2.0E-167
sp|O00088|GLNA_AGABI Glutamine synthetase OS=Agaricus bisporus GN=glnA PE=3 SV=1 17 357 5.0E-166
sp|Q8X169|GLNA_AMAMU Glutamine synthetase OS=Amanita muscaria GN=GLN1 PE=2 SV=2 17 357 7.0E-165
sp|Q96UV5|GLNA_HEBCY Glutamine synthetase OS=Hebeloma cylindrosporum GN=GLN1 PE=2 SV=1 17 355 1.0E-163
sp|Q09179|GLNA_SCHPO Glutamine synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gln1 PE=1 SV=2 5 355 4.0E-163
sp|Q8J1R3|GLNA_SUIBO Glutamine synthetase OS=Suillus bovinus GN=GLNA PE=3 SV=1 11 357 2.0E-160
sp|P16580|GLNA_CHICK Glutamine synthetase OS=Gallus gallus GN=GLUL PE=1 SV=1 17 355 3.0E-150
sp|P15104|GLNA_HUMAN Glutamine synthetase OS=Homo sapiens GN=GLUL PE=1 SV=4 17 355 8.0E-148
sp|Q9QY94|GLNA_ACOCA Glutamine synthetase OS=Acomys cahirinus GN=GLUL PE=2 SV=3 17 355 9.0E-148
sp|P15103|GLNA_BOVIN Glutamine synthetase OS=Bos taurus GN=GLUL PE=2 SV=4 17 355 1.0E-147
sp|Q8HZM5|GLNA_CANLF Glutamine synthetase OS=Canis lupus familiaris GN=GLUL PE=1 SV=3 17 355 1.0E-147
sp|P46410|GLNA_PIG Glutamine synthetase OS=Sus scrofa GN=GLUL PE=2 SV=3 17 355 4.0E-147
sp|P15105|GLNA_MOUSE Glutamine synthetase OS=Mus musculus GN=Glul PE=1 SV=6 17 355 4.0E-147
sp|P51121|GLNA_XENLA Glutamine synthetase OS=Xenopus laevis GN=glul PE=2 SV=1 16 355 1.0E-146
sp|P41320|GLNA_SQUAC Glutamine synthetase, mitochondrial OS=Squalus acanthias PE=2 SV=1 17 355 3.0E-146
sp|Q4R7U3|GLNA_MACFA Glutamine synthetase OS=Macaca fascicularis GN=GLUL PE=2 SV=3 17 355 5.0E-146
sp|P09606|GLNA_RAT Glutamine synthetase OS=Rattus norvegicus GN=Glul PE=1 SV=3 17 355 9.0E-145
sp|P20478|GLNA2_DROME Glutamine synthetase 2 cytoplasmic OS=Drosophila melanogaster GN=Gs2 PE=2 SV=3 1 354 4.0E-142
sp|Q04831|GLNA_PANAR Glutamine synthetase OS=Panulirus argus PE=2 SV=1 13 354 3.0E-137
sp|P14656|GLN11_ORYSJ Glutamine synthetase cytosolic isozyme 1-1 OS=Oryza sativa subsp. japonica GN=GLN1-1 PE=1 SV=1 7 358 8.0E-137
sp|Q43127|GLNA2_ARATH Glutamine synthetase, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=GLN2 PE=1 SV=1 7 358 1.0E-135
sp|P14655|GLNA2_ORYSJ Glutamine synthetase, chloroplastic OS=Oryza sativa subsp. japonica GN=GLN2 PE=1 SV=1 6 358 4.0E-134
sp|O22504|GLNA1_DAUCA Glutamine synthetase cytosolic isozyme OS=Daucus carota GN=GLN1 PE=2 SV=1 7 350 5.0E-134
sp|Q9LVI8|GLN13_ARATH Glutamine synthetase cytosolic isozyme 1-3 OS=Arabidopsis thaliana GN=GLN1-3 PE=1 SV=1 7 356 6.0E-134
sp|P04773|GLNA_CRIGR Glutamine synthetase OS=Cricetulus griseus GN=GLUL PE=2 SV=4 17 355 7.0E-134
sp|Q42624|GLNAC_BRANA Glutamine synthetase, chloroplastic OS=Brassica napus GN=GLN2 PE=2 SV=1 6 358 3.0E-133
sp|P38561|GLNA3_MAIZE Glutamine synthetase root isozyme 3 OS=Zea mays GN=GLN4 PE=1 SV=1 7 358 2.0E-132
sp|P34497|GLNA_CAEEL Probable glutamine synthetase OS=Caenorhabditis elegans GN=gln-2 PE=3 SV=1 11 355 9.0E-132
sp|Q56WN1|GLN11_ARATH Glutamine synthetase cytosolic isozyme 1-1 OS=Arabidopsis thaliana GN=GLN1-1 PE=1 SV=2 7 358 2.0E-131
sp|P13564|GLNA2_HORVU Glutamine synthetase leaf isozyme, chloroplastic OS=Hordeum vulgare PE=2 SV=2 26 358 4.0E-131
sp|P00965|GLNA3_PHAVU Glutamine synthetase N-1 OS=Phaseolus vulgaris GN=Gln-gamma PE=2 SV=2 7 358 6.0E-131
sp|P51119|GLNA2_VITVI Glutamine synthetase cytosolic isozyme 2 OS=Vitis vinifera GN=GS1-2 PE=2 SV=1 21 358 9.0E-131
sp|Q9XQ94|GLNA2_MEDSA Glutamine synthetase leaf isozyme, chloroplastic OS=Medicago sativa GN=GS2 PE=2 SV=1 2 355 1.0E-130
sp|P32289|GLNA_VIGAC Glutamine synthetase nodule isozyme OS=Vigna aconitifolia PE=2 SV=1 7 358 2.0E-130
sp|O82560|GLNA2_SOYBN Glutamine synthetase cytosolic isozyme 2 OS=Glycine max PE=1 SV=1 7 358 4.0E-130
sp|P15102|GLNA4_PHAVU Glutamine synthetase leaf isozyme, chloroplastic OS=Phaseolus vulgaris PE=2 SV=1 26 355 6.0E-130
sp|Q42688|GLNA1_CHLRE Glutamine synthetase cytosolic isozyme OS=Chlamydomonas reinhardtii GN=GLN1 PE=2 SV=1 21 355 6.0E-130
sp|P25462|GLNAC_MAIZE Glutamine synthetase, chloroplastic OS=Zea mays GN=GLN2 PE=2 SV=1 26 358 7.0E-130
sp|P20477|GLNA1_DROME Glutamine synthetase 1, mitochondrial OS=Drosophila melanogaster GN=Gs1 PE=2 SV=3 14 355 8.0E-130
sp|P38563|GLNA5_MAIZE Glutamine synthetase root isozyme 5 OS=Zea mays GN=GS1-5 PE=2 SV=2 7 357 8.0E-130
sp|Q42899|GLNA1_LOTJA Glutamine synthetase cytosolic isozyme OS=Lotus japonicus GN=GLN1 PE=2 SV=2 26 358 9.0E-130
sp|P52782|GLNA_LUPLU Glutamine synthetase nodule isozyme OS=Lupinus luteus PE=3 SV=1 7 355 9.0E-130
sp|P04770|GLNA1_PHAVU Glutamine synthetase PR-1 OS=Phaseolus vulgaris PE=2 SV=1 7 358 2.0E-129
sp|O22506|GLNA2_DAUCA Glutamine synthetase, chloroplastic OS=Daucus carota GN=GLN2 PE=2 SV=1 26 358 2.0E-129
sp|P04078|GLNA1_MEDSA Glutamine synthetase cytosolic isozyme OS=Medicago sativa PE=2 SV=1 26 358 2.0E-129
sp|Q43785|GLNA3_MEDSA Glutamine synthetase nodule isozyme OS=Medicago sativa GN=GS1 PE=2 SV=1 26 358 3.0E-129
sp|P12424|GLNA_NICPL Glutamine synthetase OS=Nicotiana plumbaginifolia PE=2 SV=1 7 357 3.0E-129
sp|Q9FMD9|GLN14_ARATH Glutamine synthetase cytosolic isozyme 1-4 OS=Arabidopsis thaliana GN=GLN1-4 PE=1 SV=1 7 358 4.0E-129
sp|P07694|GLNA3_PEA Glutamine synthetase root isozyme A OS=Pisum sativum GN=GS3A PE=2 SV=1 7 358 6.0E-129
sp|Q43066|GLNA4_PEA Glutamine synthetase root isozyme B OS=Pisum sativum GN=GS3B PE=3 SV=1 7 357 1.0E-128
sp|Q06378|GLNA3_HORVU Glutamine synthetase OS=Hordeum vulgare PE=2 SV=1 26 358 2.0E-128
sp|P51118|GLNA1_VITVI Glutamine synthetase cytosolic isozyme 1 OS=Vitis vinifera GN=GS1-1 PE=2 SV=1 26 358 2.0E-128
sp|P04771|GLNA2_PHAVU Glutamine synthetase PR-2 OS=Phaseolus vulgaris PE=2 SV=1 26 358 2.0E-128
sp|P38559|GLNA1_MAIZE Glutamine synthetase root isozyme 1 OS=Zea mays GN=GLN6 PE=2 SV=1 7 355 3.0E-128
sp|P08281|GLNA2_PEA Glutamine synthetase leaf isozyme, chloroplastic OS=Pisum sativum GN=GS2 PE=2 SV=2 25 355 3.0E-128
sp|P38562|GLNA4_MAIZE Glutamine synthetase root isozyme 4 OS=Zea mays GN=GLN5 PE=2 SV=1 7 358 4.0E-128
sp|Q4W8D0|GLN13_ORYSJ Glutamine synthetase cytosolic isozyme 1-3 OS=Oryza sativa subsp. japonica GN=GLN1-3 PE=2 SV=1 8 358 9.0E-128
sp|P14654|GLN12_ORYSJ Glutamine synthetase cytosolic isozyme 1-2 OS=Oryza sativa subsp. japonica GN=GLN1-2 PE=1 SV=1 7 355 2.0E-127
sp|P23712|GLNA_LACSA Glutamine synthetase OS=Lactuca sativa PE=2 SV=2 26 350 4.0E-127
sp|O04867|GLNA1_ALNGL Glutamine synthetase OS=Alnus glutinosa GN=GLN1 PE=2 SV=1 7 358 7.0E-127
sp|Q8GXW5|GLN15_ARATH Glutamine synthetase cytosolic isozyme 1-5 OS=Arabidopsis thaliana GN=GLN1-5 PE=1 SV=1 26 355 1.0E-126
sp|P08282|GLNA1_PEA Glutamine synthetase nodule isozyme OS=Pisum sativum GN=GS1 PE=2 SV=2 13 358 3.0E-126
sp|Q8LCE1|GLN12_ARATH Glutamine synthetase cytosolic isozyme 1-2 OS=Arabidopsis thaliana GN=GLN1-2 PE=1 SV=2 21 355 4.0E-126
sp|P52783|GLNA_PINSY Glutamine synthetase cytosolic isozyme OS=Pinus sylvestris PE=2 SV=1 21 358 2.0E-125
sp|P24099|GLNA1_SOYBN Glutamine synthetase cytosolic isozyme 1 OS=Glycine max PE=2 SV=1 7 358 1.0E-124
sp|P38560|GLNA2_MAIZE Glutamine synthetase root isozyme 2 OS=Zea mays GN=GLN2 PE=2 SV=1 22 358 3.0E-122
sp|Q5UR44|GLNA_MIMIV Putative glutamine synthetase OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R565 PE=3 SV=1 21 354 1.0E-115
sp|P14636|GLNA3_LUPAN Glutamine synthetase nodule isozyme (Fragment) OS=Lupinus angustifolius PE=2 SV=1 7 318 3.0E-113
sp|P19432|GLNA2_STRVR Glutamine synthetase 2 OS=Streptomyces viridochromogenes GN=glnII PE=3 SV=1 25 353 3.0E-111
sp|Q42689|GLNA2_CHLRE Glutamine synthetase, chloroplastic OS=Chlamydomonas reinhardtii GN=GLN2 PE=2 SV=1 8 355 3.0E-110
sp|P20805|GLNA2_FRAAL Glutamine synthetase 2 OS=Frankia alni GN=glnII PE=2 SV=1 25 353 2.0E-100
sp|P22878|GLNA2_STRHY Glutamine synthetase 2 OS=Streptomyces hygroscopicus GN=glnB PE=3 SV=1 25 353 7.0E-99
sp|P04772|GLNA2_BRADU Glutamine synthetase 2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=glnII PE=3 SV=2 29 358 5.0E-92
sp|P11600|GLNA_DUNSA Glutamine synthetase (Fragment) OS=Dunaliella salina PE=2 SV=1 128 355 5.0E-85
sp|Q02154|GLNA2_RHILP Glutamine synthetase 2 OS=Rhizobium leguminosarum bv. phaseoli GN=glnII PE=1 SV=3 29 348 5.0E-83
sp|P45626|GLNA2_RHIML Glutamine synthetase 2 OS=Rhizobium meliloti GN=glnII PE=3 SV=1 29 346 4.0E-81
sp|Q9ZLW5|GLNA_HELPJ Glutamine synthetase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=glnA PE=3 SV=1 61 356 2.0E-09
sp|P94845|GLNA_HELPY Glutamine synthetase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=glnA PE=3 SV=2 61 353 4.0E-09
sp|P9WN37|GLNA2_MYCTU Probable glutamine synthetase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=glnA2 PE=1 SV=1 181 353 1.0E-07
sp|P9WN36|GLNA2_MYCTO Probable glutamine synthetase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=glnA2 PE=3 SV=1 181 353 1.0E-07
sp|P64246|GLNA2_MYCBO Probable glutamine synthetase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=glnA2 PE=3 SV=1 181 353 1.0E-07
sp|O27612|GLNA_METTH Glutamine synthetase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=glnA PE=3 SV=1 61 353 5.0E-07
sp|A0R083|GLNA2_MYCS2 Probable glutamine synthetase 2 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=glnA PE=1 SV=1 186 353 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004356 glutamate-ammonia ligase activity Yes
GO:0006807 nitrogen compound metabolic process Yes
GO:0006542 glutamine biosynthetic process Yes
GO:0043436 oxoacid metabolic process No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0044283 small molecule biosynthetic process No
GO:0006541 glutamine metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0046394 carboxylic acid biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008652 cellular amino acid biosynthetic process No
GO:0008150 biological_process No
GO:0044281 small molecule metabolic process No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:0006520 cellular amino acid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0009987 cellular process No
GO:0016874 ligase activity No
GO:0019752 carboxylic acid metabolic process No
GO:1901607 alpha-amino acid biosynthetic process No
GO:0016053 organic acid biosynthetic process No
GO:0016211 ammonia ligase activity No
GO:0009084 glutamine family amino acid biosynthetic process No
GO:0016880 acid-ammonia (or amide) ligase activity No
GO:0003824 catalytic activity No
GO:1901605 alpha-amino acid metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0009058 biosynthetic process No
GO:0009064 glutamine family amino acid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4459
MASREVLSSRTETVNKYMKLDQKGSLMAEYVWIDADGEVRSKSRTLDEQKYKPEDLPIWNFDGSSTKQAPGENSD
VYLRPCAVFPDPFRGAPNIIVLTECWNADGTPNKYNYRHECDKVMKAYASHVPWFGLEQEYTFLGHDDRPYGWPT
NGYPAPQGPYYCGVGSGKVVMRDVVESHYKACLYAGVKISGTNAEVMPGQWEFQVGPCEGIQMGDHLWVARFFLA
RVAEDFGVKVSWHPKPIGGDWNGAGLHSNFSTKEMRNEGGMKFIEEALKKLEPHHMDCIKEYGEDNDKRLTGLHE
TGSIEKFTYGVANRGTSIRIPRETAAKGSGYFEDRRPASNADPYRVTKVLMTSIFGKP
Coding >Ophio5|4459
ATGGCTAGTCGCGAAGTCCTTTCCTCTCGTACAGAGACGGTCAATAAATACATGAAGCTCGATCAAAAGGGCTCT
CTTATGGCCGAGTATGTCTGGATTGATGCCGACGGCGAGGTTCGCTCCAAGTCTCGCACACTCGACGAGCAAAAA
TACAAGCCCGAAGACCTGCCCATCTGGAACTTTGACGGCTCCTCCACTAAGCAGGCCCCTGGCGAAAACTCTGAT
GTCTACCTCCGCCCCTGCGCCGTCTTCCCGGATCCCTTCCGCGGCGCGCCCAACATTATCGTACTCACCGAGTGC
TGGAACGCCGACGGCACCCCTAACAAGTACAATTACCGACACGAGTGCGACAAGGTCATGAAGGCTTATGCAAGC
CATGTCCCTTGGTTTGGCCTCGAGCAAGAGTACACTTTCCTGGGCCACGATGATCGGCCCTATGGCTGGCCTACC
AATGGATACCCTGCTCCCCAAGGGCCCTACTACTGTGGTGTCGGCAGCGGCAAAGTCGTCATGCGCGACGTCGTC
GAGTCGCATTACAAAGCTTGTTTGTATGCCGGTGTCAAGATTTCAGGAACCAACGCCGAGGTTATGCCCGGTCAA
TGGGAGTTTCAGGTCGGCCCTTGCGAGGGCATCCAAATGGGTGATCATCTCTGGGTTGCCCGATTCTTCCTGGCC
CGTGTCGCCGAAGATTTCGGCGTCAAGGTGTCGTGGCACCCGAAGCCCATCGGCGGCGACTGGAACGGCGCCGGC
CTGCACTCCAACTTCTCCACCAAGGAGATGCGCAACGAGGGCGGCATGAAGTTCATCGAGGAGGCGCTCAAGAAG
TTGGAGCCGCACCACATGGATTGCATCAAGGAGTACGGCGAAGATAACGATAAGCGCCTTACCGGCCTCCACGAG
ACGGGCTCCATCGAAAAGTTCACCTACGGCGTGGCAAACCGCGGAACCTCGATTCGGATCCCTCGCGAGACGGCC
GCCAAGGGTTCCGGCTACTTCGAAGACCGACGTCCAGCGTCCAACGCGGACCCTTATCGTGTCACCAAGGTGCTC
ATGACGTCCATCTTCGGCAAGCCA
Transcript >Ophio5|4459
ATGGCTAGTCGCGAAGTCCTTTCCTCTCGTACAGAGACGGTCAATAAATACATGAAGCTCGATCAAAAGGGCTCT
CTTATGGCCGAGTATGTCTGGATTGATGCCGACGGCGAGGTTCGCTCCAAGTCTCGCACACTCGACGAGCAAAAA
TACAAGCCCGAAGACCTGCCCATCTGGAACTTTGACGGCTCCTCCACTAAGCAGGCCCCTGGCGAAAACTCTGAT
GTCTACCTCCGCCCCTGCGCCGTCTTCCCGGATCCCTTCCGCGGCGCGCCCAACATTATCGTACTCACCGAGTGC
TGGAACGCCGACGGCACCCCTAACAAGTACAATTACCGACACGAGTGCGACAAGGTCATGAAGGCTTATGCAAGC
CATGTCCCTTGGTTTGGCCTCGAGCAAGAGTACACTTTCCTGGGCCACGATGATCGGCCCTATGGCTGGCCTACC
AATGGATACCCTGCTCCCCAAGGGCCCTACTACTGTGGTGTCGGCAGCGGCAAAGTCGTCATGCGCGACGTCGTC
GAGTCGCATTACAAAGCTTGTTTGTATGCCGGTGTCAAGATTTCAGGAACCAACGCCGAGGTTATGCCCGGTCAA
TGGGAGTTTCAGGTCGGCCCTTGCGAGGGCATCCAAATGGGTGATCATCTCTGGGTTGCCCGATTCTTCCTGGCC
CGTGTCGCCGAAGATTTCGGCGTCAAGGTGTCGTGGCACCCGAAGCCCATCGGCGGCGACTGGAACGGCGCCGGC
CTGCACTCCAACTTCTCCACCAAGGAGATGCGCAACGAGGGCGGCATGAAGTTCATCGAGGAGGCGCTCAAGAAG
TTGGAGCCGCACCACATGGATTGCATCAAGGAGTACGGCGAAGATAACGATAAGCGCCTTACCGGCCTCCACGAG
ACGGGCTCCATCGAAAAGTTCACCTACGGCGTGGCAAACCGCGGAACCTCGATTCGGATCCCTCGCGAGACGGCC
GCCAAGGGTTCCGGCTACTTCGAAGACCGACGTCCAGCGTCCAACGCGGACCCTTATCGTGTCACCAAGGTGCTC
ATGACGTCCATCTTCGGCAAGCCATGA
Gene >Ophio5|4459
ATGGTAGGATGACCCTGCTGTCTGCCTTTCTTCCAACTAACAACTGCTAACCGGCCGTTTCTTCGCTCGCAGGCT
AGTCGCGAAGTCCTTTCCTCTCGTACAGAGACGGTATGTGTTGCAACTCGCCCAAAGCCGCCTACGACCGAGGCT
GACGATACTCCACAGGTCAATAAATACATGAAGCTCGATCAAAAGGGCTCTCTTATGGCCGAGTATGTCTGGATT
GATGCCGACGGCGAGGTTCGCTCCAAGTCTCGCGTGAGTCTCTCTCTCTCTCACTCACTTCCTCTCTTCCACTTC
TGGTCTCGCCGCCTGTCGCACGCCGGAGACCACATCCACGCCGTGCGCCGTCGCTTCGTCGTCGACGGCCCCGCT
CCCGGCATACCCTGACCAATCGCACCGTCTCTCACTGTCATCCATTCCTTCTCTGCACTGCACCCTTCCGATGGC
GACGCTACTATATCCATACAACCCTCTGCTGACACGCTGCTGCAGACACTCGACGAGCAAAAATACAAGCCCGAA
GACCTGCCCATCTGGAACTTTGACGGCTCCTCCACTAAGCAGGCCCCTGGCGAAAACTCTGATGTCTACCTCCGC
CCCTGCGCCGTCTTCCCGGATCCCTTCCGCGGCGCGCCCAACATTATCGTACTCACCGAGTGCTGGAACGCCGAC
GGCACCCCTAACAAGTACAATTACCGACACGAGTGCGACAAGGTCATGAAGGCTTATGCAAGCCATGTCCCTTGG
TTTGGCCTCGAGCAAGAGTACACTTTCCTGGGCCACGATGATCGGCCCTATGGCTGGCCTACCAATGGATACCCT
GCTCCGTAAGCCACATCGTCGTCTTGCATTAGCCTCGGCTCGCTGACCCCCTGTCCAGCCAAGGGCCCTACTACT
GTGGTGTCGGCAGCGGCAAAGTCGTCATGCGCGACGTCGTCGAGTCGCATTACAAAGCTTGTTTGTGTATGTTGC
CCGGCGTCGTCGTCGTCATCGTGCTTCCATTTTGCTGACGCGAGTGACCAGATGCCGGTGTCAAGATTTCAGGAA
CCAACGCCGAGGTTATGCCCGGTCAATGGGAGTTTCAGGTCGGCCCTTGCGAGGGCATCCAAAGTGCGTACTGTT
CTGCCGCCCCCACCAACACGCATGGTAAAGCATGACTGACGTCAGTGCGCAGTGGGTGATCATCTCTGGGTTGCC
CGATTCTTCCTGGCCCGTGTCGCCGAAGATTTCGGCGTCAAGGTGTCGTGGCACCCGAAGCCCATCGGCGGCGAC
TGGAACGGCGCCGGCCTGCACTCCAACTTCTCCACCAAGGAGATGCGCAACGAGGGCGGCATGAAGTTCATCGAG
GAGGCGCTCAAGAAGTTGGAGCCGCACCACATGGATTGCATCAAGGAGTACGGCGAAGATAACGATAAGCGCCTT
ACCGGCCTCCACGAGACGGGCTCCATCGAAAAGTTCACCTACGGCGTGGCAAACCGCGGAACCTCGATTCGGATC
CCTCGCGAGACGGCCGCCAAGGGTTCCGGCTACTTCGAAGACCGACGTCCAGCGTCCAACGCGGACCCTTATCGT
GTCACCAAGGTGCTCATGACGTCCATCTTCGGCAAGCCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail