Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4449
Gene name
Locationscaffold_352:10277..13200
Strand+
Gene length (bp)2923
Transcript length (bp)2661
Coding sequence length (bp)2658
Protein length (aa) 886

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5A2J7|YVC1_CANAL Calcium channel YVC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YVC1 PE=2 SV=1 263 782 3.0E-137
sp|Q12324|YVC1_YEAST Calcium channel YVC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YVC1 PE=1 SV=2 258 775 2.0E-118
sp|Q61143|TRPC6_MOUSE Short transient receptor potential channel 6 OS=Mus musculus GN=Trpc6 PE=1 SV=3 479 717 5.0E-06
sp|Q9Y210|TRPC6_HUMAN Short transient receptor potential channel 6 OS=Homo sapiens GN=TRPC6 PE=1 SV=1 479 717 8.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 456 473 17
2 488 505 17
3 512 534 22
4 549 571 22
5 592 611 19
6 653 675 22
7 737 756 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4449
MRLFRWTGEASIRRHWRASEGISDSTAEQTDDLMRDENHKGRATLNAGRPNDVDLHGASPMSRATFGRLVGIFCT
LCPGRGLTSSSSLSNLWGWGWDGVSLEVEARDYVKRRRPVSSTYLPTYTTRRNHHPGPLQNLPLPYRRWQSWWPD
LCPDWDDVSLILVLGPPRPGPSKPPPPSPPSPPQLPPQSPSMSLDCPAILTLYHIHYSFVMPGVSRWSAIDRALG
FSNQRSRRRDDHWLRQEERVLIPHFGRRPEQYAVPPLEATKICLRLRRLIQECVPCEMEESRITTPHGRIITSKV
LLAAQEAGGREHRSCVAFCLLVNYRWFQQEALAELWDSSLHQLRKEACAVVAKAIIDDEQDMAYLMHDILLRRYS
IIIDGAPTKPFNVIEKAVDLHAVRIIGSSGFQKCISHLWRGWLVQDADDPSIFVDYEDRDNTKFLVHMDPNRMRV
PKYQNIAQLFFSLIYLALYTAAVNSVNPTGVLDGAEVIMYAFTVGFVCDEVVKVYKAGYHILGFWNGFNAILYAF
LMVSLVFRIVGLTGPSDSDDRRHYSTLSYNLLSFVAPMFWSRLLLYLDSFKFFGAMLVVLKVMMKESIIFFALLI
IIVIGFLQAFIGLDLTDDNVAGDALFIVEAMIKAILQSPEFEGFESFGPPWGIVLYYCFAFVVMIILLNILIALY
NSAYSDIYDNADDEYLALFSQKTLQFIRAPDENVYIAPLNLVELAVSGLLEWWMDKKTYERINDYIMGFLYSPLL
FATAYFETRVAHDIRRNRASGEDDDDVVEEWEQLSHELDFEAEGWIKTCDAVKPNLEDDAAAVEVRRLRAEFEEL
KAVMKDMNKASGATQTRHEDSTTGDPANGESRTKQGDTSGRGTSDTAQASDKSGSDKGRGN
Coding >Ophio5|4449
ATGCGACTTTTTCGTTGGACAGGCGAGGCGAGCATCAGACGGCATTGGAGGGCATCGGAGGGCATTTCGGACTCG
ACGGCAGAACAGACAGACGATCTGATGCGTGACGAAAACCACAAAGGGCGTGCGACGTTGAATGCTGGCCGGCCC
AATGACGTGGACTTGCATGGCGCGTCACCGATGAGCCGTGCCACCTTTGGCCGTCTCGTGGGCATCTTCTGCACT
CTCTGTCCAGGACGTGGCCTGACGTCGTCGTCGTCGTTGTCCAACTTGTGGGGATGGGGCTGGGATGGGGTGTCT
TTGGAGGTTGAGGCTCGGGATTATGTAAAACGACGTCGTCCCGTCTCGAGCACCTACCTACCTACCTACACGACC
CGAAGAAACCATCATCCGGGACCTCTCCAGAATCTCCCTCTCCCATACCGTCGTTGGCAGTCATGGTGGCCCGAC
CTGTGCCCCGATTGGGACGACGTATCCCTGATACTTGTACTTGGACCCCCTCGTCCTGGTCCGAGCAAGCCTCCT
CCTCCGTCGCCTCCGTCGCCCCCACAGCTTCCTCCTCAGTCACCATCTATGAGCCTCGATTGTCCCGCCATCTTG
ACGCTTTACCACATCCACTACAGCTTCGTCATGCCCGGCGTCTCCCGTTGGAGCGCCATCGACCGCGCTCTGGGC
TTCTCCAATCAGCGGTCTCGCCGTCGTGACGACCACTGGCTTCGTCAGGAGGAACGCGTTCTGATCCCCCACTTT
GGCCGCCGCCCTGAACAATATGCCGTGCCGCCCCTCGAGGCTACAAAGATCTGCTTGCGCCTCCGACGCTTGATC
CAGGAATGCGTCCCTTGCGAGATGGAGGAGAGCCGTATCACGACTCCTCACGGTCGCATCATCACGTCAAAGGTC
CTCTTGGCCGCTCAGGAAGCCGGTGGCCGGGAGCACCGAAGCTGCGTCGCATTTTGCCTGCTCGTCAACTACCGC
TGGTTCCAGCAAGAAGCTCTAGCCGAACTCTGGGACTCTTCCCTCCACCAGCTGCGCAAGGAGGCCTGCGCCGTT
GTGGCCAAAGCCATCATCGACGACGAGCAAGACATGGCCTATCTCATGCACGACATCCTCCTCCGTCGCTACTCC
ATCATCATCGACGGCGCCCCCACGAAGCCTTTCAACGTCATCGAAAAGGCTGTCGACTTGCACGCCGTCCGCATC
ATCGGCTCATCCGGCTTTCAAAAGTGCATCAGCCATCTCTGGCGAGGCTGGCTCGTCCAGGATGCAGATGACCCT
TCAATCTTTGTCGACTACGAGGACAGGGACAACACAAAGTTTCTCGTCCACATGGATCCCAACCGCATGAGGGTG
CCCAAGTATCAAAACATCGCCCAGCTGTTCTTCTCCCTCATCTACCTCGCCCTCTACACCGCTGCCGTCAACTCG
GTCAATCCGACTGGGGTGCTCGATGGCGCCGAGGTCATCATGTACGCCTTCACTGTTGGATTCGTATGCGACGAG
GTCGTCAAGGTATACAAGGCCGGCTACCACATTCTGGGCTTTTGGAACGGCTTCAATGCCATTCTTTACGCCTTC
CTGATGGTGTCGCTCGTCTTCCGCATCGTCGGCTTGACGGGTCCGAGCGACTCTGACGATCGCCGGCACTACAGC
ACCCTGAGCTACAACCTCCTTTCCTTTGTCGCCCCCATGTTCTGGTCGCGGCTGTTGTTGTATCTCGACAGCTTC
AAGTTCTTCGGTGCCATGCTCGTTGTGCTCAAGGTGATGATGAAAGAGTCCATCATATTCTTCGCCCTTCTCATC
ATCATCGTCATCGGCTTTCTCCAGGCCTTTATCGGTCTCGATTTGACCGACGACAACGTCGCCGGGGACGCCTTG
TTCATCGTCGAGGCCATGATCAAGGCCATTCTGCAGAGTCCCGAGTTTGAGGGGTTTGAGAGTTTTGGACCGCCA
TGGGGCATCGTTCTCTACTACTGCTTCGCCTTCGTCGTCATGATTATCCTTCTCAACATTCTCATCGCCCTCTAC
AACTCGGCCTACTCGGACATTTACGACAATGCCGACGACGAGTACCTCGCGCTTTTCTCGCAAAAGACGTTGCAA
TTCATCCGCGCGCCCGACGAAAACGTGTACATTGCGCCCTTGAACCTCGTCGAACTCGCCGTCTCGGGCCTGCTG
GAGTGGTGGATGGACAAGAAGACGTACGAGCGCATCAACGACTACATCATGGGCTTCCTGTACTCGCCTCTGCTC
TTCGCCACGGCCTACTTTGAGACGCGTGTGGCACATGACATACGACGAAACCGTGCGAGTGGCGAAGATGACGAC
GACGTGGTGGAGGAATGGGAACAGCTCTCTCACGAGCTCGACTTTGAGGCTGAAGGATGGATCAAGACGTGCGAC
GCTGTGAAGCCGAACCTGGAGGACGACGCTGCAGCTGTCGAAGTCAGGCGTCTGCGGGCCGAGTTTGAGGAGCTC
AAGGCAGTGATGAAGGATATGAACAAAGCCAGCGGTGCCACGCAGACCCGACATGAAGACTCTACGACCGGGGAC
CCCGCCAATGGAGAATCGCGGACTAAACAAGGCGACACGTCGGGTCGCGGAACGTCGGATACCGCCCAGGCTTCG
GATAAGTCTGGGTCCGACAAAGGCAGAGGCAAC
Transcript >Ophio5|4449
ATGCGACTTTTTCGTTGGACAGGCGAGGCGAGCATCAGACGGCATTGGAGGGCATCGGAGGGCATTTCGGACTCG
ACGGCAGAACAGACAGACGATCTGATGCGTGACGAAAACCACAAAGGGCGTGCGACGTTGAATGCTGGCCGGCCC
AATGACGTGGACTTGCATGGCGCGTCACCGATGAGCCGTGCCACCTTTGGCCGTCTCGTGGGCATCTTCTGCACT
CTCTGTCCAGGACGTGGCCTGACGTCGTCGTCGTCGTTGTCCAACTTGTGGGGATGGGGCTGGGATGGGGTGTCT
TTGGAGGTTGAGGCTCGGGATTATGTAAAACGACGTCGTCCCGTCTCGAGCACCTACCTACCTACCTACACGACC
CGAAGAAACCATCATCCGGGACCTCTCCAGAATCTCCCTCTCCCATACCGTCGTTGGCAGTCATGGTGGCCCGAC
CTGTGCCCCGATTGGGACGACGTATCCCTGATACTTGTACTTGGACCCCCTCGTCCTGGTCCGAGCAAGCCTCCT
CCTCCGTCGCCTCCGTCGCCCCCACAGCTTCCTCCTCAGTCACCATCTATGAGCCTCGATTGTCCCGCCATCTTG
ACGCTTTACCACATCCACTACAGCTTCGTCATGCCCGGCGTCTCCCGTTGGAGCGCCATCGACCGCGCTCTGGGC
TTCTCCAATCAGCGGTCTCGCCGTCGTGACGACCACTGGCTTCGTCAGGAGGAACGCGTTCTGATCCCCCACTTT
GGCCGCCGCCCTGAACAATATGCCGTGCCGCCCCTCGAGGCTACAAAGATCTGCTTGCGCCTCCGACGCTTGATC
CAGGAATGCGTCCCTTGCGAGATGGAGGAGAGCCGTATCACGACTCCTCACGGTCGCATCATCACGTCAAAGGTC
CTCTTGGCCGCTCAGGAAGCCGGTGGCCGGGAGCACCGAAGCTGCGTCGCATTTTGCCTGCTCGTCAACTACCGC
TGGTTCCAGCAAGAAGCTCTAGCCGAACTCTGGGACTCTTCCCTCCACCAGCTGCGCAAGGAGGCCTGCGCCGTT
GTGGCCAAAGCCATCATCGACGACGAGCAAGACATGGCCTATCTCATGCACGACATCCTCCTCCGTCGCTACTCC
ATCATCATCGACGGCGCCCCCACGAAGCCTTTCAACGTCATCGAAAAGGCTGTCGACTTGCACGCCGTCCGCATC
ATCGGCTCATCCGGCTTTCAAAAGTGCATCAGCCATCTCTGGCGAGGCTGGCTCGTCCAGGATGCAGATGACCCT
TCAATCTTTGTCGACTACGAGGACAGGGACAACACAAAGTTTCTCGTCCACATGGATCCCAACCGCATGAGGGTG
CCCAAGTATCAAAACATCGCCCAGCTGTTCTTCTCCCTCATCTACCTCGCCCTCTACACCGCTGCCGTCAACTCG
GTCAATCCGACTGGGGTGCTCGATGGCGCCGAGGTCATCATGTACGCCTTCACTGTTGGATTCGTATGCGACGAG
GTCGTCAAGGTATACAAGGCCGGCTACCACATTCTGGGCTTTTGGAACGGCTTCAATGCCATTCTTTACGCCTTC
CTGATGGTGTCGCTCGTCTTCCGCATCGTCGGCTTGACGGGTCCGAGCGACTCTGACGATCGCCGGCACTACAGC
ACCCTGAGCTACAACCTCCTTTCCTTTGTCGCCCCCATGTTCTGGTCGCGGCTGTTGTTGTATCTCGACAGCTTC
AAGTTCTTCGGTGCCATGCTCGTTGTGCTCAAGGTGATGATGAAAGAGTCCATCATATTCTTCGCCCTTCTCATC
ATCATCGTCATCGGCTTTCTCCAGGCCTTTATCGGTCTCGATTTGACCGACGACAACGTCGCCGGGGACGCCTTG
TTCATCGTCGAGGCCATGATCAAGGCCATTCTGCAGAGTCCCGAGTTTGAGGGGTTTGAGAGTTTTGGACCGCCA
TGGGGCATCGTTCTCTACTACTGCTTCGCCTTCGTCGTCATGATTATCCTTCTCAACATTCTCATCGCCCTCTAC
AACTCGGCCTACTCGGACATTTACGACAATGCCGACGACGAGTACCTCGCGCTTTTCTCGCAAAAGACGTTGCAA
TTCATCCGCGCGCCCGACGAAAACGTGTACATTGCGCCCTTGAACCTCGTCGAACTCGCCGTCTCGGGCCTGCTG
GAGTGGTGGATGGACAAGAAGACGTACGAGCGCATCAACGACTACATCATGGGCTTCCTGTACTCGCCTCTGCTC
TTCGCCACGGCCTACTTTGAGACGCGTGTGGCACATGACATACGACGAAACCGTGCGAGTGGCGAAGATGACGAC
GACGTGGTGGAGGAATGGGAACAGCTCTCTCACGAGCTCGACTTTGAGGCTGAAGGATGGATCAAGACGTGCGAC
GCTGTGAAGCCGAACCTGGAGGACGACGCTGCAGCTGTCGAAGTCAGGCGTCTGCGGGCCGAGTTTGAGGAGCTC
AAGGCAGTGATGAAGGATATGAACAAAGCCAGCGGTGCCACGCAGACCCGACATGAAGACTCTACGACCGGGGAC
CCCGCCAATGGAGAATCGCGGACTAAACAAGGCGACACGTCGGGTCGCGGAACGTCGGATACCGCCCAGGCTTCG
GATAAGTCTGGGTCCGACAAAGGCAGAGGCAACTAA
Gene >Ophio5|4449
ATGCGACTTTTTCGTTGGACAGGCGAGGCGAGCATCAGACGGCATTGGAGGGCATCGGAGGGCATTTCGGACTCG
ACGGCAGAACAGACAGACGATCTGATGCGTGACGAAAACCACAAAGGGCGTGCGACGTTGAATGCTGGCCGGCCC
AATGACGTGGACTTGCATGGCGCGTCACCGATGAGCCGTGCCACCTTTGGCCGTCTCGTGGGCATCTTCTGCACT
CTCTGTCCAGGACGTGGCCTGACGTCGTCGTCGTCGTTGTCCAACTTGTGGGGATGGGGCTGGGATGGGGTGTCT
TTGGAGGTTGAGGCTCGGGATTATGTAAAACGACGTCGTCCCGTCTCGAGCACCTACCTACCTACCTACACGGTT
AAACAACCCACCTACCACCTAATCTATCGACTGGGATAGATAGACCCGAAGAAACCATCATCCGGGACCTCTCCA
GAATCTCCCTCTCCCATACCGTCGTTGGCAGTCATGGTGGCCCGACCTGTGCCCCGATTGGGACGACGTATCCCT
GATACTTGTACTTGGACCCCCTCGTCCTGGTCCGAGCAAGCCTCCTCCTCCGTCGCCTCCGTCGCCCCCACAGCT
TCCTCCTCAGTCACCATCTATGAGCCTCGATTGTCCCGCCATCTTGACGCTTTACCACATCCACTACAGCTTCGT
CATGCCCGGCGTCTCCCGTTGGAGCGCCATCGACCGCGCTCTGGGCTTCTCCAATCAGCGGTCTCGCCGTCGTGA
CGACCACTGGCTTCGTCAGGAGGAACGCGTTCGTCAGTCGACCTCATCCAGCACAATAGACCCGTCGACTGATTC
TCTCCAGTGATCCCCCACTTTGGCCGCCGCCCTGAACAATATGCCGTGCCGCCCCTCGAGGCTACAAAGATCTGC
TTGCGCCTCCGACGCTTGATCCAGGAATGCGTCCCTTGCGAGATGGAGGAGAGCCGTATCACGACTCCTCACGGT
CGCATCATCACGTCAAAGGTCCTCTTGGCCGCTCAGGAAGCCGGTGGCCGGGAGCACCGAAGCTGCGTCGTGCGT
CATCTCCCATCGCGGCTCTCGCCGTATCCAGTCTTACCATCTCATCCTCGCTAGGCATTTTGCCTGCTCGTCAAC
TACCGCTGGTTCCAGCAAGAAGCTCTAGCCGAACTCTGGGACTCTTCCCTCCACCAGCTGCGCAAGGAGGCCTGC
GCCGTTGTGGCCAAAGCCATGTTCGTCTCGTCCCGTCTAACCCTGTCCACCAAATACTCACCCCCCGTGCTCAGC
ATCGACGACGAGCAAGACATGGCCTATCTCATGCACGACATCCTCCTCCGTCGCTACTCCATCATCATCGACGGC
GCCCCCACGAAGCCTTTCAACGTCATCGAAAAGGCTGTCGACTTGCACGCCGTCCGCATCATCGGCTCATCCGGC
TTTCAAAAGTGCATCAGCCATCTCTGGCGAGGCTGGCTCGTCCAGGATGCAGATGACCCTTCAATCTTTGTCGAC
TACGAGGACAGGGACAACACAAAGTTTCTCGTCCACATGGATCCCAACCGCATGAGGGTGCCCAAGTATCAAAAC
ATCGCCCAGCTGTTCTTCTCCCTCATCTACCTCGCCCTCTACACCGCTGCCGTCAACTCGGTCAATCCGACTGGG
GTGCTCGATGGCGCCGAGGTCATCATGTACGCCTTCACTGTTGGATTCGTATGCGACGAGGTCGTCAAGGTATAC
AAGGCCGGCTACCACATTCTGGGCTTTTGGAACGGCTTCAATGCCATTCTTTACGCCTTCCTGATGGTGTCGCTC
GTCTTCCGCATCGTCGGCTTGACGGGTCCGAGCGACTCTGACGATCGCCGGCACTACAGCACCCTGAGCTACAAC
CTCCTTTCCTTTGTCGCCCCCATGTTCTGGTCGCGGCTGTTGTTGTATCTCGACAGCTTCAAGTTCTTCGGTGCC
ATGCTCGTTGTGCTCAAGGTGATGATGAAAGAGTCCATCATATTCTTCGCCCTTCTCATCATCATCGTCATCGGC
TTTCTCCAGGCCTTTATCGGTCTCGATTTGACCGACGACAACGTCGCCGGGGACGCCTTGTTCATCGTCGAGGCC
ATGATCAAGGCCATTCTGCAGAGTCCCGAGTTTGAGGGGTTTGAGAGTTTTGGACCGCCATGGGGCATCGTTCTC
TACTACTGCTTCGCCTTCGTCGTCATGGTATGCCAGAGTCTGGCCGTGTGTTGACGACCGAGAACTGACGCAGCC
AAAGATTATCCTTCTCAACATTCTCATCGCCCTCTACAACTCGGCCTACTCGGACATTTACGACAATGCCGACGA
CGAGTACCTCGCGCTTTTCTCGCAAAAGACGTTGCAATTCATCCGCGCGCCCGACGAAAACGTGTACATTGCGCC
CTTGAACCTCGTCGAACTCGCCGTCTCGGGCCTGCTGGAGTGGTGGATGGACAAGAAGACGTACGAGCGCATCAA
CGACTACATCATGGGCTTCCTGTACTCGCCTCTGCTCTTCGCCACGGCCTACTTTGAGACGCGTGTGGCACATGA
CATACGACGAAACCGTGCGAGTGGCGAAGATGACGACGACGTGGTGGAGGAATGGGAACAGCTCTCTCACGAGCT
CGACTTTGAGGCTGAAGGATGGATCAAGACGTGCGACGCTGTGAAGCCGAACCTGGAGGACGACGCTGCAGCTGT
CGAAGTCAGGCGTCTGCGGGCCGAGTTTGAGGAGCTCAAGGCAGTGATGAAGGATATGAACAAAGCCAGCGGTGC
CACGCAGACCCGACATGAAGACTCTACGACCGGGGACCCCGCCAATGGAGAATCGCGGACTAAACAAGGCGACAC
GTCGGGTCGCGGAACGTCGGATACCGCCCAGGCTTCGGATAAGTCTGGGTCCGACAAAGGCAGAGGCAACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail