Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4444
Gene name
Locationscaffold_351:18043..19418
Strand+
Gene length (bp)1375
Transcript length (bp)1278
Coding sequence length (bp)1275
Protein length (aa) 425

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02469 Fasciclin Fasciclin domain 2.7E-15 107 234
PF02469 Fasciclin Fasciclin domain 4.7E-26 247 398

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P74615|Y1483_SYNY3 Uncharacterized protein sll1483 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1483 PE=3 SV=1 96 236 2.0E-08
sp|Q15582|BGH3_HUMAN Transforming growth factor-beta-induced protein ig-h3 OS=Homo sapiens GN=TGFBI PE=1 SV=1 127 407 7.0E-08
sp|Q62009|POSTN_MOUSE Periostin OS=Mus musculus GN=Postn PE=1 SV=2 132 334 4.0E-07
sp|Q9NY15|STAB1_HUMAN Stabilin-1 OS=Homo sapiens GN=STAB1 PE=1 SV=3 88 250 4.0E-07
sp|Q8R4Y4|STAB1_MOUSE Stabilin-1 OS=Mus musculus GN=Stab1 PE=1 SV=1 91 248 3.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4444
MRSVLISALFGAVALVSASDWSQVPLSGPTDHDADELSLARGPLVPQVSSLLSHAVDRLAGAVDSAAIDVLQGAR
HPRLSTELADSLGARGGRERTVYELIRACEHTSRFADAVDDHPDVVKLLNGTSSRDLTLFVPTNEAFRGLPDGHR
PGRSFVERVLRYHVGLGRYPAGRILHTHTLPTALEEELLGGESQRLRTSIGLGGVEINFYSKVVAINIEASNGII
HAVNHILIPPFMVGRILSLFPSQFSTLLLAYEKTDFVDFIHHVSLNGSTVFAPSNNAFGRLGPKANAFLFNTSKG
RRYLRALLKYHISPNATLYTDAFYDETTEDAAGRPSAEGLEREHYDLPTLLGDARISVDIARLGGFSAVRINGFS
HISVRDGVAKNGVIQVVDQVLMPPRKGRPSGRPRRALTVRELMARLEPYL
Coding >Ophio5|4444
ATGAGGTCCGTCCTCATCTCCGCCCTCTTCGGCGCCGTCGCCCTCGTCTCGGCCTCGGATTGGTCCCAAGTGCCG
CTCTCCGGACCGACGGATCACGATGCCGACGAGCTCTCTCTTGCACGCGGCCCACTCGTTCCTCAGGTGTCGTCA
CTGCTGAGCCACGCTGTGGATCGGCTGGCTGGAGCTGTTGATAGCGCCGCCATCGATGTCCTTCAGGGGGCTCGT
CATCCGAGGCTGTCCACTGAACTGGCTGACTCGCTCGGCGCTCGGGGTGGCCGCGAGCGTACTGTTTACGAGCTG
ATTCGCGCTTGTGAGCATACGTCTCGCTTTGCTGATGCCGTTGATGATCATCCGGACGTGGTTAAGCTGCTCAAT
GGGACGTCGAGTCGCGATTTGACCCTCTTTGTGCCTACCAACGAGGCCTTCCGTGGTCTACCGGATGGTCATCGT
CCGGGGCGAAGCTTTGTCGAGCGTGTTCTGCGTTATCATGTTGGACTTGGCCGCTATCCGGCTGGTCGAATTTTG
CATACGCATACGCTGCCCACTGCCCTAGAGGAGGAGCTGCTGGGCGGAGAGTCTCAGCGGCTGCGGACGAGCATC
GGTCTTGGGGGGGTTGAAATCAACTTTTACAGCAAAGTTGTGGCTATCAACATCGAAGCCTCTAACGGCATCATC
CACGCCGTCAATCACATCCTCATCCCCCCCTTCATGGTCGGCCGTATCCTCTCCCTCTTTCCCAGTCAGTTCTCG
ACGCTGCTACTGGCCTACGAAAAGACCGACTTCGTCGACTTCATTCACCACGTCAGCCTCAACGGCAGCACCGTC
TTCGCCCCGAGCAACAACGCCTTCGGCCGTCTCGGTCCCAAGGCAAATGCCTTTCTCTTCAACACCTCCAAGGGC
CGTCGCTATCTCCGCGCCCTACTGAAATACCACATCTCGCCCAACGCGACGCTCTACACAGACGCCTTCTACGAC
GAAACGACCGAGGACGCGGCTGGACGTCCGTCGGCCGAGGGCCTCGAGCGTGAGCACTACGATCTTCCGACGCTA
CTGGGCGACGCGCGAATCAGCGTCGATATCGCTCGTTTGGGAGGCTTTTCTGCTGTTCGCATAAACGGCTTCTCT
CACATCTCGGTCCGCGATGGCGTCGCCAAGAACGGTGTCATTCAGGTCGTCGATCAGGTTCTGATGCCGCCCCGG
AAGGGCCGTCCGTCTGGTAGACCCCGGAGGGCGCTGACGGTCCGTGAGCTCATGGCGAGGTTGGAGCCGTATCTG
Transcript >Ophio5|4444
ATGAGGTCCGTCCTCATCTCCGCCCTCTTCGGCGCCGTCGCCCTCGTCTCGGCCTCGGATTGGTCCCAAGTGCCG
CTCTCCGGACCGACGGATCACGATGCCGACGAGCTCTCTCTTGCACGCGGCCCACTCGTTCCTCAGGTGTCGTCA
CTGCTGAGCCACGCTGTGGATCGGCTGGCTGGAGCTGTTGATAGCGCCGCCATCGATGTCCTTCAGGGGGCTCGT
CATCCGAGGCTGTCCACTGAACTGGCTGACTCGCTCGGCGCTCGGGGTGGCCGCGAGCGTACTGTTTACGAGCTG
ATTCGCGCTTGTGAGCATACGTCTCGCTTTGCTGATGCCGTTGATGATCATCCGGACGTGGTTAAGCTGCTCAAT
GGGACGTCGAGTCGCGATTTGACCCTCTTTGTGCCTACCAACGAGGCCTTCCGTGGTCTACCGGATGGTCATCGT
CCGGGGCGAAGCTTTGTCGAGCGTGTTCTGCGTTATCATGTTGGACTTGGCCGCTATCCGGCTGGTCGAATTTTG
CATACGCATACGCTGCCCACTGCCCTAGAGGAGGAGCTGCTGGGCGGAGAGTCTCAGCGGCTGCGGACGAGCATC
GGTCTTGGGGGGGTTGAAATCAACTTTTACAGCAAAGTTGTGGCTATCAACATCGAAGCCTCTAACGGCATCATC
CACGCCGTCAATCACATCCTCATCCCCCCCTTCATGGTCGGCCGTATCCTCTCCCTCTTTCCCAGTCAGTTCTCG
ACGCTGCTACTGGCCTACGAAAAGACCGACTTCGTCGACTTCATTCACCACGTCAGCCTCAACGGCAGCACCGTC
TTCGCCCCGAGCAACAACGCCTTCGGCCGTCTCGGTCCCAAGGCAAATGCCTTTCTCTTCAACACCTCCAAGGGC
CGTCGCTATCTCCGCGCCCTACTGAAATACCACATCTCGCCCAACGCGACGCTCTACACAGACGCCTTCTACGAC
GAAACGACCGAGGACGCGGCTGGACGTCCGTCGGCCGAGGGCCTCGAGCGTGAGCACTACGATCTTCCGACGCTA
CTGGGCGACGCGCGAATCAGCGTCGATATCGCTCGTTTGGGAGGCTTTTCTGCTGTTCGCATAAACGGCTTCTCT
CACATCTCGGTCCGCGATGGCGTCGCCAAGAACGGTGTCATTCAGGTCGTCGATCAGGTTCTGATGCCGCCCCGG
AAGGGCCGTCCGTCTGGTAGACCCCGGAGGGCGCTGACGGTCCGTGAGCTCATGGCGAGGTTGGAGCCGTATCTG
TAG
Gene >Ophio5|4444
ATGAGGTCCGTCCTCATCTCCGCCCTCTTCGGCGCCGTCGCCCTCGTCTCGGCCTCGGATTGGTCCCAAGTGCCG
CTCTCCGGACCGACGGATCACGATGCCGACGAGCTCTCTCTTGCACGCGGCCCACTCGTTCCTCAGGTGTCGTCA
CTGCTGAGCCACGCTGTGGATCGGCTGGCTGGAGCTGTTGATAGCGCCGCCATCGATGTCCTTCAGGGGGCTCGT
CATCCGAGGCTGTCCACTGAACTGGCTGACTCGCTCGGCGCTCGGGGTGGCCGCGAGCGTACTGTTTACGAGCTG
ATTCGCGCTTGTGAGCATACGTCTCGCTTTGCTGATGCCGTTGATGATCATCCGGACGTGGTTAAGCTGCTCAAT
GGGACGTCGAGTCGCGATTTGACCCTCTTTGTGCCTACCAACGAGGCCTTCCGTGGTCTACCGGATGGTCATCGT
CCGGGGCGAAGCTTTGTCGAGCGTGTTCTGCGTTATCATGTTGGACTTGGCCGCTATCCGGCTGGTCGAATTTTG
CATACGCATACGCTGCCCACTGCCCTAGAGGAGGAGCTGCTGGGCGGAGAGTCTCAGCGGCTGCGGACGAGCATC
GGTCTTGGGGGGGTTGAAATCAACTTTTACAGCAAAGTTGTGGCTATCAACATCGTACGCAAACCCTTTTCTCTC
TTTGTCCTCCCCGTCTCGCCGTGTGTTTTCACCGGCCTCTCTCCTTACATCTGCCACGAACTAACAGCCCTAAAA
GGAAGCCTCTAACGGCATCATCCACGCCGTCAATCACATCCTCATCCCCCCCTTCATGGTCGGCCGTATCCTCTC
CCTCTTTCCCAGTCAGTTCTCGACGCTGCTACTGGCCTACGAAAAGACCGACTTCGTCGACTTCATTCACCACGT
CAGCCTCAACGGCAGCACCGTCTTCGCCCCGAGCAACAACGCCTTCGGCCGTCTCGGTCCCAAGGCAAATGCCTT
TCTCTTCAACACCTCCAAGGGCCGTCGCTATCTCCGCGCCCTACTGAAATACCACATCTCGCCCAACGCGACGCT
CTACACAGACGCCTTCTACGACGAAACGACCGAGGACGCGGCTGGACGTCCGTCGGCCGAGGGCCTCGAGCGTGA
GCACTACGATCTTCCGACGCTACTGGGCGACGCGCGAATCAGCGTCGATATCGCTCGTTTGGGAGGCTTTTCTGC
TGTTCGCATAAACGGCTTCTCTCACATCTCGGTCCGCGATGGCGTCGCCAAGAACGGTGTCATTCAGGTCGTCGA
TCAGGTTCTGATGCCGCCCCGGAAGGGCCGTCCGTCTGGTAGACCCCGGAGGGCGCTGACGGTCCGTGAGCTCAT
GGCGAGGTTGGAGCCGTATCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail