Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4434
Gene name
Locationscaffold_350:11695..13572
Strand+
Gene length (bp)1877
Transcript length (bp)1671
Coding sequence length (bp)1668
Protein length (aa) 556

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00324 AA_permease Amino acid permease 4.0E-122 59 508
PF13520 AA_permease_2 Amino acid permease 7.5E-26 63 472

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P43548|AGP3_YEAST General amino acid permease AGP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGP3 PE=1 SV=1 13 538 0.0E+00
sp|O59831|YCUB_SCHPO Uncharacterized amino-acid permease C965.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.11c PE=3 SV=1 36 554 2.0E-157
sp|P04817|CAN1_YEAST Arginine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAN1 PE=1 SV=2 1 556 1.0E-102
sp|P32487|LYP1_YEAST Lysine-specific permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYP1 PE=1 SV=2 48 553 4.0E-101
sp|O60170|MEU22_SCHPO Probable amino-acid permease meu22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=meu22 PE=2 SV=1 7 532 2.0E-95
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P43548|AGP3_YEAST General amino acid permease AGP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGP3 PE=1 SV=1 13 538 0.0E+00
sp|O59831|YCUB_SCHPO Uncharacterized amino-acid permease C965.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.11c PE=3 SV=1 36 554 2.0E-157
sp|P04817|CAN1_YEAST Arginine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAN1 PE=1 SV=2 1 556 1.0E-102
sp|P32487|LYP1_YEAST Lysine-specific permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYP1 PE=1 SV=2 48 553 4.0E-101
sp|O60170|MEU22_SCHPO Probable amino-acid permease meu22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=meu22 PE=2 SV=1 7 532 2.0E-95
sp|P19145|GAP1_YEAST General amino-acid permease GAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAP1 PE=1 SV=2 22 555 1.0E-94
sp|P06775|HIP1_YEAST Histidine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HIP1 PE=1 SV=2 36 551 1.0E-92
sp|P38971|ALP1_YEAST Basic amino-acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALP1 PE=1 SV=2 13 556 2.0E-92
sp|P43059|CAN1_CANAW Lysine/arginine permease OS=Candida albicans (strain WO-1) GN=CAN1 PE=3 SV=2 35 552 5.0E-86
sp|P34054|INDA1_HYPAT Amino-acid permease inda1 OS=Hypocrea atroviridis GN=inda1 PE=2 SV=1 51 552 7.0E-86
sp|P25376|AGP1_YEAST General amino acid permease AGP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGP1 PE=1 SV=3 3 552 1.0E-82
sp|Q9C0V0|YQD2_SCHPO Probable amino-acid permease PB1C11.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCPB1C11.02 PE=3 SV=1 39 535 4.0E-82
sp|A6ZTG5|AGP1_YEAS7 General amino acid permease AGP1 OS=Saccharomyces cerevisiae (strain YJM789) GN=AGP1 PE=3 SV=1 3 552 1.0E-81
sp|P53388|DIP5_YEAST Dicarboxylic amino acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIP5 PE=1 SV=1 46 540 7.0E-81
sp|Q876K6|AGP1_SACU7 General amino acid permease AGP1 OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) GN=AGP1 PE=3 SV=1 22 552 3.0E-79
sp|Q9P5N2|AAT1_SCHPO Amino acid transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aat1 PE=3 SV=1 5 554 2.0E-78
sp|P41815|BAP3_YEAST Valine amino-acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BAP3 PE=1 SV=2 20 555 2.0E-78
sp|Q9P768|YI26_SCHPO Uncharacterized amino-acid permease P7G5.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP7G5.06 PE=3 SV=1 46 537 2.0E-78
sp|Q9URZ3|PUT4_SCHPO Probable proline-specific permease put4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=put4 PE=3 SV=1 17 524 2.0E-77
sp|Q12372|MMP1_YEAST S-methylmethionine permease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MMP1 PE=1 SV=1 52 556 2.0E-77
sp|P38084|BAP2_YEAST Leu/Val/Ile amino-acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BAP2 PE=1 SV=2 6 555 2.0E-76
sp|Q9URZ4|CAT1_SCHPO Cationic amino acid transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cat1 PE=1 SV=3 49 545 2.0E-76
sp|P15380|PUT4_YEAST Proline-specific permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUT4 PE=2 SV=2 35 541 5.0E-76
sp|P48813|GNP1_YEAST High-affinity glutamine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GNP1 PE=1 SV=2 14 555 3.0E-74
sp|P25737|LYSP_ECOLI Lysine-specific permease OS=Escherichia coli (strain K12) GN=lysP PE=1 SV=5 39 505 8.0E-74
sp|P38967|TAT2_YEAST Tryptophan permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAT2 PE=1 SV=1 33 543 5.0E-73
sp|Q9P5N4|YH81_SCHPO Uncharacterized amino-acid permease C359.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC359.01 PE=3 SV=2 51 554 1.0E-72
sp|O74543|YCV4_SCHPO Uncharacterized amino-acid permease C777.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC777.04 PE=3 SV=1 7 522 1.0E-72
sp|P18696|PUTX_EMENI Proline-specific permease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prnB PE=2 SV=2 19 531 8.0E-72
sp|B5BP45|YP51_SCHPO Uncharacterized amino-acid permease C460.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.01c PE=3 SV=1 36 540 1.0E-71
sp|P38090|AGP2_YEAST General amino acid permease AGP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGP2 PE=1 SV=1 43 536 7.0E-71
sp|P38085|TAT1_YEAST Valine/tyrosine/tryptophan amino-acid permease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAT1 PE=1 SV=1 12 533 2.0E-66
sp|P40901|ISP5_SCHPO Sexual differentiation process putative amino-acid permease isp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp5 PE=2 SV=2 7 555 2.0E-64
sp|Q92367|AAP1_SCHPO Amino-acid permease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aap1 PE=3 SV=1 35 550 8.0E-63
sp|Q08986|SAM3_YEAST S-adenosylmethionine permease SAM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAM3 PE=1 SV=1 52 555 2.0E-62
sp|P39137|ROCE_BACSU Amino-acid permease RocE OS=Bacillus subtilis (strain 168) GN=rocE PE=2 SV=1 42 519 1.0E-61
sp|Q9HDV2|YHE1_SCHPO Uncharacterized amino-acid permease PB2B2.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB2B2.01 PE=3 SV=1 2 527 9.0E-60
sp|P24207|PHEP_ECOLI Phenylalanine-specific permease OS=Escherichia coli (strain K12) GN=pheP PE=1 SV=1 35 463 2.0E-57
sp|P15993|AROP_ECOLI Aromatic amino acid transport protein AroP OS=Escherichia coli (strain K12) GN=aroP PE=1 SV=3 51 442 1.0E-56
sp|Q8FL49|AROP_ECOL6 Aromatic amino acid transport protein AroP OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aroP PE=3 SV=1 51 442 1.0E-56
sp|P59737|AROP_SHIFL Aromatic amino acid transport protein AroP OS=Shigella flexneri GN=aroP PE=3 SV=1 51 442 1.0E-56
sp|Q8X968|AROP_ECO57 Aromatic amino acid transport protein AroP OS=Escherichia coli O157:H7 GN=aroP PE=3 SV=1 51 442 3.0E-56
sp|P46349|GABP_BACSU GABA permease OS=Bacillus subtilis (strain 168) GN=gabP PE=1 SV=3 46 465 1.0E-55
sp|P0CK99|AROP_SALTY Aromatic amino acid transport protein AroP OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aroP PE=3 SV=1 51 457 3.0E-55
sp|E1W822|AROP_SALTS Aromatic amino acid transport protein AroP OS=Salmonella typhimurium (strain SL1344) GN=aroP PE=3 SV=1 51 457 3.0E-55
sp|P0A188|AROP_SALTI Aromatic amino acid transport protein AroP OS=Salmonella typhi GN=aroP PE=3 SV=1 51 457 3.0E-55
sp|P39636|ROCC_BACSU Amino-acid permease RocC OS=Bacillus subtilis (strain 168) GN=rocC PE=2 SV=1 46 462 4.0E-53
sp|P25527|GABP_ECOLI GABA permease OS=Escherichia coli (strain K12) GN=gabP PE=1 SV=1 54 473 1.0E-50
sp|P0A4W1|ANSP2_MYCBO L-asparagine permease 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ansP2 PE=3 SV=1 48 485 4.0E-50
sp|P9WQM6|ANSP2_MYCTO L-asparagine permease 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ansP2 PE=3 SV=1 48 485 4.0E-50
sp|P9WQM7|ANSP2_MYCTU L-asparagine permease 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ansP2 PE=1 SV=1 48 485 4.0E-50
sp|P77610|ANSP_ECOLI L-asparagine permease OS=Escherichia coli (strain K12) GN=ansP PE=3 SV=2 48 536 1.0E-48
sp|Q47689|MMUP_ECOLI Probable S-methylmethionine permease OS=Escherichia coli (strain K12) GN=mmuP PE=3 SV=2 43 501 1.0E-47
sp|P9WQM9|ANSP1_MYCTU L-asparagine permease 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ansP1 PE=1 SV=1 48 460 5.0E-47
sp|P9WQM8|ANSP1_MYCTO L-asparagine permease 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ansP1 PE=3 SV=1 48 460 5.0E-47
sp|Q7VEQ4|ANSP1_MYCBO L-asparagine permease 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ansP1 PE=3 SV=1 34 460 6.0E-47
sp|P40812|ANSP_SALTY L-asparagine permease OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ansP PE=3 SV=1 48 460 3.0E-46
sp|P42087|HUTM_BACSU Putative histidine permease OS=Bacillus subtilis (strain 168) GN=hutM PE=3 SV=2 46 458 5.0E-46
sp|O34618|YTNA_BACSU Uncharacterized amino acid permease YtnA OS=Bacillus subtilis (strain 168) GN=ytnA PE=3 SV=1 51 472 1.0E-44
sp|Q9X7P0|ANSP_STRCO L-asparagine permease OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=ansP PE=3 SV=1 21 439 4.0E-44
sp|P0A190|YIFK_SALTI Probable transport protein YifK OS=Salmonella typhi GN=yifK PE=3 SV=1 43 463 6.0E-44
sp|P0A189|YIFK_SALTY Probable transport protein YifK OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=yifK PE=3 SV=1 43 463 6.0E-44
sp|O31462|YBGF_BACSU Uncharacterized amino acid permease YbgF OS=Bacillus subtilis (strain 168) GN=ybgF PE=3 SV=1 48 458 7.0E-44
sp|P27837|YIFK_ECOLI Probable transport protein YifK OS=Escherichia coli (strain K12) GN=yifK PE=1 SV=4 43 463 1.0E-43
sp|P37460|PROY_SALTY Proline-specific permease ProY OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=proY PE=3 SV=3 45 436 2.0E-43
sp|Q03770|SSY1_YEAST SPS-sensor component SSY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSY1 PE=1 SV=1 51 533 2.0E-43
sp|P96704|YDGF_BACSU Uncharacterized transporter YdgF OS=Bacillus subtilis (strain 168) GN=ydgF PE=3 SV=1 43 472 1.0E-42
sp|Q46065|AROP_CORGL Aromatic amino acid transport protein AroP OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=aroP PE=3 SV=1 46 458 9.0E-42
sp|O06005|AAPA_BACSU Amino-acid permease AapA OS=Bacillus subtilis (strain 168) GN=aapA PE=3 SV=2 41 472 4.0E-40
sp|O32257|YVBW_BACSU Uncharacterized amino acid permease YvbW OS=Bacillus subtilis (strain 168) GN=yvbW PE=2 SV=1 46 465 1.0E-39
sp|P54425|YBXG_BACSU Uncharacterized transporter YbxG OS=Bacillus subtilis (strain 168) GN=ybxG PE=3 SV=2 48 461 1.0E-39
sp|P0AAE2|PROY_ECOLI Proline-specific permease ProY OS=Escherichia coli (strain K12) GN=proY PE=1 SV=1 45 436 2.0E-39
sp|P0AAE3|PROY_ECOL6 Proline-specific permease ProY OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=proY PE=3 SV=1 45 436 2.0E-39
sp|P0AAE4|PROY_ECO57 Proline-specific permease ProY OS=Escherichia coli O157:H7 GN=proY PE=3 SV=1 45 436 2.0E-39
sp|Q9I703|BAUD_PSEAE Probable GABA permease OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=bauD PE=2 SV=1 48 460 9.0E-39
sp|P0AAE0|CYCA_ECOLI D-serine/D-alanine/glycine transporter OS=Escherichia coli (strain K12) GN=cycA PE=1 SV=1 34 436 1.0E-33
sp|P0AAE1|CYCA_ECO57 D-serine/D-alanine/glycine transporter OS=Escherichia coli O157:H7 GN=cycA PE=3 SV=1 34 436 1.0E-33
sp|P45495|YPEV_LACDL Uncharacterized transporter in pepV 3'region (Fragment) OS=Lactobacillus delbrueckii subsp. lactis PE=3 SV=1 39 205 3.0E-18
sp|P94383|YCGH_BACSU Uncharacterized transporter YcgH OS=Bacillus subtilis (strain 168) GN=ycgH PE=3 SV=3 59 372 2.0E-09
sp|Q58026|Y609_METJA Uncharacterized protein MJ0609 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0609 PE=1 SV=1 177 373 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.45

Transmembrane Domains

Domain # Start End Length
1 59 81 22
2 85 104 19
3 141 163 22
4 168 190 22
5 197 219 22
6 245 267 22
7 288 310 22
8 340 362 22
9 382 404 22
10 408 430 22
11 454 476 22
12 486 508 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4434
MFHGPKVESDGDKLSTEPRPVQEDDDETPRYGAIESPSMRADSDVDPDSGVRRGLKNRHLSMMALAGIIGPGLLV
GAGGALNSGGPASLLIGFAILGVIAFAVMQSLGEVTTLFPGGGSFVSLAERMVDKSFSVAIGWNYFVIWAAVLAN
EYNVICSILTYWAPAVPLWGFFIILWALFCAFQLLGVEAFGEAEFWLALFKMLGLAAYFLFSIVYASGAVAAQTE
PLGFRYWRDPGAFNGNGFRGVAVVFVFCSTFYAGIESVAVAATEARNPGAAVPQAIRQVFWRIIFVYIGSAIFFG
ITCPANAPGLVNGGAKALQSPMTIAIQNAGWQGGVHLINAFILITCLSAINSSIYIGSRTLLYMAQSGKAPSFIG
WTNRRGVPVWAIVITNAFGAIAMMNVSTGASKAYGYIVNLSGVSTFIVWGGISLIHMRFRRAWAVQGRSLDDIPF
RSKWYPYIAYIGLGANTFLAFVQGWTSLFPFDAANFVDAYILLPLFGLIYGTCKLYWRGRDKLKRSWEIDLDSGR
RTDLDKTETATETGSPELARASLWKRVWNLL
Coding >Ophio5|4434
ATGTTCCATGGCCCCAAAGTCGAGTCCGACGGCGACAAGCTGTCGACGGAGCCGCGGCCCGTACAAGAAGACGAC
GACGAGACTCCCCGCTACGGCGCCATCGAGTCGCCCAGCATGCGGGCCGACAGCGACGTGGATCCGGATTCGGGC
GTCAGACGAGGCCTCAAGAACAGGCACCTGTCTATGATGGCTCTTGCCGGCATCATTGGTCCGGGTTTACTGGTT
GGCGCTGGCGGCGCGCTCAACAGTGGCGGGCCGGCCTCGCTGCTCATCGGCTTCGCTATCCTCGGCGTCATCGCC
TTTGCCGTCATGCAATCCCTCGGCGAGGTGACAACCCTCTTCCCCGGCGGCGGCTCCTTCGTCTCCCTGGCCGAG
CGCATGGTCGACAAATCCTTCTCCGTTGCCATCGGCTGGAACTACTTCGTCATCTGGGCTGCCGTCCTGGCCAAC
GAGTACAACGTCATCTGCAGCATTCTCACCTACTGGGCGCCAGCAGTCCCGCTCTGGGGCTTCTTCATCATCCTC
TGGGCCCTCTTCTGCGCCTTTCAGCTTCTCGGTGTCGAGGCTTTTGGGGAGGCCGAGTTCTGGCTGGCTCTCTTC
AAGATGCTCGGCCTCGCCGCTTACTTCCTCTTCTCTATCGTCTACGCCTCTGGAGCAGTCGCGGCTCAGACCGAA
CCCCTTGGCTTCCGCTACTGGCGTGACCCCGGCGCATTCAATGGCAATGGTTTTCGCGGCGTCGCCGTCGTCTTC
GTCTTCTGCTCTACTTTTTATGCCGGCATCGAGTCCGTCGCCGTCGCCGCCACCGAGGCCCGGAACCCCGGTGCC
GCCGTGCCCCAGGCCATTCGCCAGGTCTTCTGGCGCATCATCTTCGTCTACATCGGCTCCGCCATCTTCTTCGGA
ATTACCTGCCCGGCCAATGCTCCGGGCTTGGTCAATGGCGGCGCAAAGGCTCTCCAGAGTCCCATGACAATTGCC
ATCCAGAATGCCGGTTGGCAGGGAGGCGTCCATCTGATCAACGCCTTCATCTTAATCACCTGTCTGTCCGCCATC
AACTCGTCCATCTACATCGGCTCCCGAACACTCCTGTACATGGCCCAGTCCGGCAAGGCACCCTCCTTCATCGGC
TGGACCAACAGAAGGGGCGTCCCCGTCTGGGCCATTGTCATCACCAACGCCTTCGGCGCCATTGCCATGATGAAC
GTGTCGACGGGCGCATCCAAGGCGTACGGCTACATCGTCAACCTCTCAGGCGTGAGCACCTTTATCGTCTGGGGC
GGCATCAGCCTGATTCACATGCGCTTCCGCCGCGCTTGGGCCGTCCAGGGGCGCAGCCTGGACGATATACCCTTC
CGAAGCAAATGGTATCCCTACATTGCATACATTGGGCTCGGCGCCAATACTTTCCTGGCATTTGTCCAGGGCTGG
ACGAGCCTCTTTCCCTTCGACGCTGCAAACTTCGTCGACGCCTACATTCTCCTCCCGCTCTTCGGCCTGATCTAC
GGCACCTGCAAGCTGTACTGGCGGGGACGAGATAAGCTCAAACGAAGCTGGGAAATCGACCTCGACAGCGGCCGG
CGGACAGACCTGGACAAGACGGAGACTGCCACCGAGACGGGGTCTCCCGAGCTGGCGAGGGCTTCGCTGTGGAAA
AGGGTATGGAACCTGCTT
Transcript >Ophio5|4434
ATGTTCCATGGCCCCAAAGTCGAGTCCGACGGCGACAAGCTGTCGACGGAGCCGCGGCCCGTACAAGAAGACGAC
GACGAGACTCCCCGCTACGGCGCCATCGAGTCGCCCAGCATGCGGGCCGACAGCGACGTGGATCCGGATTCGGGC
GTCAGACGAGGCCTCAAGAACAGGCACCTGTCTATGATGGCTCTTGCCGGCATCATTGGTCCGGGTTTACTGGTT
GGCGCTGGCGGCGCGCTCAACAGTGGCGGGCCGGCCTCGCTGCTCATCGGCTTCGCTATCCTCGGCGTCATCGCC
TTTGCCGTCATGCAATCCCTCGGCGAGGTGACAACCCTCTTCCCCGGCGGCGGCTCCTTCGTCTCCCTGGCCGAG
CGCATGGTCGACAAATCCTTCTCCGTTGCCATCGGCTGGAACTACTTCGTCATCTGGGCTGCCGTCCTGGCCAAC
GAGTACAACGTCATCTGCAGCATTCTCACCTACTGGGCGCCAGCAGTCCCGCTCTGGGGCTTCTTCATCATCCTC
TGGGCCCTCTTCTGCGCCTTTCAGCTTCTCGGTGTCGAGGCTTTTGGGGAGGCCGAGTTCTGGCTGGCTCTCTTC
AAGATGCTCGGCCTCGCCGCTTACTTCCTCTTCTCTATCGTCTACGCCTCTGGAGCAGTCGCGGCTCAGACCGAA
CCCCTTGGCTTCCGCTACTGGCGTGACCCCGGCGCATTCAATGGCAATGGTTTTCGCGGCGTCGCCGTCGTCTTC
GTCTTCTGCTCTACTTTTTATGCCGGCATCGAGTCCGTCGCCGTCGCCGCCACCGAGGCCCGGAACCCCGGTGCC
GCCGTGCCCCAGGCCATTCGCCAGGTCTTCTGGCGCATCATCTTCGTCTACATCGGCTCCGCCATCTTCTTCGGA
ATTACCTGCCCGGCCAATGCTCCGGGCTTGGTCAATGGCGGCGCAAAGGCTCTCCAGAGTCCCATGACAATTGCC
ATCCAGAATGCCGGTTGGCAGGGAGGCGTCCATCTGATCAACGCCTTCATCTTAATCACCTGTCTGTCCGCCATC
AACTCGTCCATCTACATCGGCTCCCGAACACTCCTGTACATGGCCCAGTCCGGCAAGGCACCCTCCTTCATCGGC
TGGACCAACAGAAGGGGCGTCCCCGTCTGGGCCATTGTCATCACCAACGCCTTCGGCGCCATTGCCATGATGAAC
GTGTCGACGGGCGCATCCAAGGCGTACGGCTACATCGTCAACCTCTCAGGCGTGAGCACCTTTATCGTCTGGGGC
GGCATCAGCCTGATTCACATGCGCTTCCGCCGCGCTTGGGCCGTCCAGGGGCGCAGCCTGGACGATATACCCTTC
CGAAGCAAATGGTATCCCTACATTGCATACATTGGGCTCGGCGCCAATACTTTCCTGGCATTTGTCCAGGGCTGG
ACGAGCCTCTTTCCCTTCGACGCTGCAAACTTCGTCGACGCCTACATTCTCCTCCCGCTCTTCGGCCTGATCTAC
GGCACCTGCAAGCTGTACTGGCGGGGACGAGATAAGCTCAAACGAAGCTGGGAAATCGACCTCGACAGCGGCCGG
CGGACAGACCTGGACAAGACGGAGACTGCCACCGAGACGGGGTCTCCCGAGCTGGCGAGGGCTTCGCTGTGGAAA
AGGGTATGGAACCTGCTTTAG
Gene >Ophio5|4434
ATGTTCCATGGCCCCAAAGTCGAGTCCGACGGCGACAAGCTGTCGACGGAGCCGCGGCCCGTACAAGAAGACGAC
GACGAGACTCCCCGCTACGGCGCCATCGAGTCGCCCAGCATGCGGGCCGACAGCGACGTGGATCCGGATTCGGGC
GTCAGACGAGGCCTCAAGAACAGGCACCTGTCTATGATGGCTCTTGCCGGCATCATTGGTCCGGGTTTACTGGTT
GGCGCTGGCGGCGCGCTCAACAGTGGCGGGCCGGCCTCGCTGCTCATCGGCTTCGCTATCCTCGGTATTTGTTTT
CTGTTTCTGCGCCTGCTTTGGCAGTACTTGCGAGACTCTTTCTGGCTCTTGTTGATTATCATCATCATCATCATC
ATCATCATCATCATCATCATGGTTTCCTCCCCACTGACGCTCCAGCAGGCGTCATCGCCTTTGCCGTCATGCAAT
CCCTCGGCGAGGTGACAACCCTCTTCCCCGGCGGCGGCTCCTTCGTCTCCCTGGCCGAGCGCATGGTCGACAAAT
CCTTCTCCGTTGCCATCGGCTGGAACTACTTCGTCATCTGGGCTGCCGTCCTGGCCAACGAGTACAACGTCATCT
GCAGCATTCTCACCTACTGGGCGCCAGCAGTCCCGCTCTGGGGCTTCTTCATCATCCTCTGGGCCCTCTTCTGCG
CCTTTCAGCTTCTCGGTGTCGAGGCTTTTGGGGAGGCCGAGTTCTGGCTGGCTCTCTTCAAGATGCTCGGCCTCG
CCGCTTACTTCCTCTTCTCTATCGTCTACGCCTCTGGAGCAGTCGCGGCTCAGACCGAACCCCTTGGCTTCCGCT
ACTGGCGTGACCCCGGCGCATTCAATGGCAATGGTTTTCGCGGCGTCGCCGTCGTCTTCGTCTTCTGCTCTACTT
TTTATGCCGGCATCGAGTCCGTCGCCGTCGCCGCCACCGAGGCCCGGAACCCCGGTGCCGCCGTGCCCCAGGCCA
TTCGCCAGGTCTTCTGGCGCATCATCTTCGTCTACATCGGCTCCGCCATCTTCTTCGGAATTACCTGCCCGGCCA
ATGCTCCGGGCTTGGTCAATGGCGGCGCAAAGGCTCTCCAGAGTCCCATGACAATTGCCATCCAGAATGCCGGTT
GGCAGGGAGGTTGGTTCTGTTCCTACTAACAATCTCCCAATGATGGACGCTGCCGCTGACCACGAGCCCCGTCTG
GACTAGGCGTCCATCTGATCAACGCCTTCATCTTAATCACCTGTCTGTCCGCCATCAACTCGTCCATCTACATCG
GCTCCCGAACACTCCTGTACATGGCCCAGTCCGGCAAGGCACCCTCCTTCATCGGCTGGACCAACAGAAGGGGCG
TCCCCGTCTGGGCCATTGTCATCACCAACGCCTTCGGCGCCATTGCCATGATGAACGTGTCGACGGGCGCATCCA
AGGCGTACGGCTACATCGTCAACCTCTCAGGCGTGAGCACCTTTATCGTCTGGGGCGGCATCAGCCTGATTCACA
TGCGCTTCCGCCGCGCTTGGGCCGTCCAGGGGCGCAGCCTGGACGATATACCCTTCCGAAGCAAATGGTATCCCT
ACATTGCATACATTGGGCTCGGCGCCAATACTTTCCTGGCATTTGTCCAGGGCTGGACGAGCCTCTTTCCCTTCG
ACGCTGCAAACTTCGTCGACGCCTACATTCTCCTCCCGCTCTTCGGCCTGATCTACGGCACCTGCAAGCTGTACT
GGCGGGGACGAGATAAGCTCAAACGAAGCTGGGAAATCGACCTCGACAGCGGCCGGCGGACAGACCTGGACAAGA
CGGAGACTGCCACCGAGACGGGGTCTCCCGAGCTGGCGAGGGCTTCGCTGTGGAAAAGGGTATGGAACCTGCTTT
AG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail