Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|443
Gene name
Locationscaffold_110:1100..2213
Strand-
Gene length (bp)1113
Transcript length (bp)1113
Coding sequence length (bp)1110
Protein length (aa) 370

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P14248|RPB1_PLAFD DNA-directed RNA polymerase II subunit RPB1 OS=Plasmodium falciparum (isolate CDC / Honduras) GN=RPII PE=3 SV=1 168 323 3.0E-08
sp|Q9L7Q2|ZMPB_STRPN Zinc metalloprotease ZmpB OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=zmpB PE=3 SV=2 167 362 7.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|443
MKQSSTSPLALVAMAAASQAASVTFWTLDQAQRTIYFTPNPGSAQMSPLTVGHLQNTTAKFPSNWAGNFYAVQSD
GENKPGMLGEVQFSGWLGRTYFDVSAIVDGTDHSNVKQMWPKLSRSPMSGCEVFPCNNCYWLPDDIQTKVTEEND
LMATLGSGSTGIVFAKPDQEAPDSSQAHHAPQYQPSAPSPPAAPPALPVQPGAAPAVAPYQPVQPVQPAAAPAAP
QYQPVQPVQPVAAPAAPQYQPVAIPAAPQSQPSQSAASPSQPSQSTASEAQPSQSTVSEAQPSQSAVSEAQSIQS
AVSEAQSSQSAVSEAQPSQSASPPDEEPASSQDQSDSNDEQPDPSEYQPQDKEAASFEYQPPSQPSMQDT
Coding >Ophio5|443
ATGAAGCAGTCTTCAACCTCTCCCCTCGCCCTGGTGGCCATGGCGGCCGCTTCGCAGGCGGCAAGCGTCACCTTC
TGGACGCTGGACCAGGCTCAGCGCACCATCTACTTTACCCCCAACCCTGGTTCAGCCCAGATGAGCCCCTTGACT
GTCGGTCACCTGCAAAACACGACGGCCAAGTTCCCCTCGAATTGGGCGGGCAACTTTTACGCTGTCCAGAGCGAC
GGGGAGAACAAGCCCGGCATGCTGGGCGAGGTCCAGTTCTCAGGCTGGCTCGGCAGGACGTACTTTGACGTGTCG
GCCATTGTCGACGGCACAGATCACTCCAACGTCAAGCAGATGTGGCCCAAGCTGAGCCGGAGCCCCATGTCCGGC
TGTGAGGTTTTCCCGTGCAACAATTGCTACTGGCTGCCGGACGACATCCAGACCAAGGTGACGGAGGAGAACGAT
CTTATGGCTACGCTGGGCTCCGGCTCGACGGGCATCGTTTTTGCCAAGCCGGACCAAGAGGCTCCCGACTCTTCG
CAAGCTCATCATGCTCCTCAGTATCAGCCTTCAGCTCCGTCCCCGCCTGCTGCGCCTCCGGCTCTACCTGTTCAG
CCTGGTGCCGCTCCTGCTGTTGCTCCATATCAGCCCGTTCAGCCCGTTCAGCCCGCTGCTGCCCCTGCGGCCCCT
CAATATCAGCCTGTTCAGCCTGTTCAGCCTGTTGCTGCTCCTGCGGCTCCCCAGTACCAACCTGTTGCTATTCCT
GCTGCTCCTCAAAGCCAGCCGAGCCAGTCTGCCGCGTCTCCATCTCAGCCGAGCCAGTCTACTGCCTCTGAAGCT
CAGCCGAGCCAGTCTACTGTCTCTGAAGCTCAACCGAGCCAATCTGCTGTCTCTGAAGCTCAGTCGATTCAATCT
GCTGTCTCTGAAGCTCAGTCGAGTCAATCTGCTGTCTCTGAAGCTCAGCCAAGCCAGTCTGCTTCTCCTCCAGAT
GAAGAGCCGGCTTCCTCGCAAGACCAGAGTGACTCAAACGACGAACAACCGGACCCTTCGGAGTACCAGCCACAA
GACAAAGAAGCGGCTTCTTTCGAGTACCAGCCGCCTTCACAGCCGTCTATGCAAGACACA
Transcript >Ophio5|443
ATGAAGCAGTCTTCAACCTCTCCCCTCGCCCTGGTGGCCATGGCGGCCGCTTCGCAGGCGGCAAGCGTCACCTTC
TGGACGCTGGACCAGGCTCAGCGCACCATCTACTTTACCCCCAACCCTGGTTCAGCCCAGATGAGCCCCTTGACT
GTCGGTCACCTGCAAAACACGACGGCCAAGTTCCCCTCGAATTGGGCGGGCAACTTTTACGCTGTCCAGAGCGAC
GGGGAGAACAAGCCCGGCATGCTGGGCGAGGTCCAGTTCTCAGGCTGGCTCGGCAGGACGTACTTTGACGTGTCG
GCCATTGTCGACGGCACAGATCACTCCAACGTCAAGCAGATGTGGCCCAAGCTGAGCCGGAGCCCCATGTCCGGC
TGTGAGGTTTTCCCGTGCAACAATTGCTACTGGCTGCCGGACGACATCCAGACCAAGGTGACGGAGGAGAACGAT
CTTATGGCTACGCTGGGCTCCGGCTCGACGGGCATCGTTTTTGCCAAGCCGGACCAAGAGGCTCCCGACTCTTCG
CAAGCTCATCATGCTCCTCAGTATCAGCCTTCAGCTCCGTCCCCGCCTGCTGCGCCTCCGGCTCTACCTGTTCAG
CCTGGTGCCGCTCCTGCTGTTGCTCCATATCAGCCCGTTCAGCCCGTTCAGCCCGCTGCTGCCCCTGCGGCCCCT
CAATATCAGCCTGTTCAGCCTGTTCAGCCTGTTGCTGCTCCTGCGGCTCCCCAGTACCAACCTGTTGCTATTCCT
GCTGCTCCTCAAAGCCAGCCGAGCCAGTCTGCCGCGTCTCCATCTCAGCCGAGCCAGTCTACTGCCTCTGAAGCT
CAGCCGAGCCAGTCTACTGTCTCTGAAGCTCAACCGAGCCAATCTGCTGTCTCTGAAGCTCAGTCGATTCAATCT
GCTGTCTCTGAAGCTCAGTCGAGTCAATCTGCTGTCTCTGAAGCTCAGCCAAGCCAGTCTGCTTCTCCTCCAGAT
GAAGAGCCGGCTTCCTCGCAAGACCAGAGTGACTCAAACGACGAACAACCGGACCCTTCGGAGTACCAGCCACAA
GACAAAGAAGCGGCTTCTTTCGAGTACCAGCCGCCTTCACAGCCGTCTATGCAAGACACATAA
Gene >Ophio5|443
ATGAAGCAGTCTTCAACCTCTCCCCTCGCCCTGGTGGCCATGGCGGCCGCTTCGCAGGCGGCAAGCGTCACCTTC
TGGACGCTGGACCAGGCTCAGCGCACCATCTACTTTACCCCCAACCCTGGTTCAGCCCAGATGAGCCCCTTGACT
GTCGGTCACCTGCAAAACACGACGGCCAAGTTCCCCTCGAATTGGGCGGGCAACTTTTACGCTGTCCAGAGCGAC
GGGGAGAACAAGCCCGGCATGCTGGGCGAGGTCCAGTTCTCAGGCTGGCTCGGCAGGACGTACTTTGACGTGTCG
GCCATTGTCGACGGCACAGATCACTCCAACGTCAAGCAGATGTGGCCCAAGCTGAGCCGGAGCCCCATGTCCGGC
TGTGAGGTTTTCCCGTGCAACAATTGCTACTGGCTGCCGGACGACATCCAGACCAAGGTGACGGAGGAGAACGAT
CTTATGGCTACGCTGGGCTCCGGCTCGACGGGCATCGTTTTTGCCAAGCCGGACCAAGAGGCTCCCGACTCTTCG
CAAGCTCATCATGCTCCTCAGTATCAGCCTTCAGCTCCGTCCCCGCCTGCTGCGCCTCCGGCTCTACCTGTTCAG
CCTGGTGCCGCTCCTGCTGTTGCTCCATATCAGCCCGTTCAGCCCGTTCAGCCCGCTGCTGCCCCTGCGGCCCCT
CAATATCAGCCTGTTCAGCCTGTTCAGCCTGTTGCTGCTCCTGCGGCTCCCCAGTACCAACCTGTTGCTATTCCT
GCTGCTCCTCAAAGCCAGCCGAGCCAGTCTGCCGCGTCTCCATCTCAGCCGAGCCAGTCTACTGCCTCTGAAGCT
CAGCCGAGCCAGTCTACTGTCTCTGAAGCTCAACCGAGCCAATCTGCTGTCTCTGAAGCTCAGTCGATTCAATCT
GCTGTCTCTGAAGCTCAGTCGAGTCAATCTGCTGTCTCTGAAGCTCAGCCAAGCCAGTCTGCTTCTCCTCCAGAT
GAAGAGCCGGCTTCCTCGCAAGACCAGAGTGACTCAAACGACGAACAACCGGACCCTTCGGAGTACCAGCCACAA
GACAAAGAAGCGGCTTCTTTCGAGTACCAGCCGCCTTCACAGCCGTCTATGCAAGACACATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail