Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4412
Gene name
Locationscaffold_35:34873..36667
Strand-
Gene length (bp)1794
Transcript length (bp)1545
Coding sequence length (bp)1542
Protein length (aa) 514

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 3.6E-23 86 219
PF08031 BBE Berberine and berberine like 2.4E-04 468 511

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 51 509 2.0E-24
sp|Q54H55|Y8969_DICDI FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum GN=DDB_G0289697 PE=2 SV=1 72 506 1.0E-19
sp|Q796Y5|YGAK_BACSU Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) GN=ygaK PE=3 SV=4 86 511 6.0E-15
sp|O06997|YVDP_BACSU Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) GN=yvdP PE=1 SV=1 52 507 6.0E-15
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 65 506 1.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 51 509 2.0E-24
sp|Q54H55|Y8969_DICDI FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum GN=DDB_G0289697 PE=2 SV=1 72 506 1.0E-19
sp|Q796Y5|YGAK_BACSU Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) GN=ygaK PE=3 SV=4 86 511 6.0E-15
sp|O06997|YVDP_BACSU Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) GN=yvdP PE=1 SV=1 52 507 6.0E-15
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 65 506 1.0E-13
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 55 350 9.0E-10
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 96 251 5.0E-09
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 91 322 8.0E-08
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 192 334 9.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0036094 small molecule binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 7 26 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4412
MNRIAQTAALWLALVGTLVAGSPLHASKFPRYFQRSPFTRRDLSIVQVQYELGAVLSNGTAIFGPRSSAWGNATE
RWNTFAMPHIEIVIEVKTEADVSKVVKYCNDNSIEFLAYSRGHGFTSTLTKFRGIEINLSQLTAITIQPDGESAW
FQGGTYGKMIIETLWDRGYVTTTGSSGCVGLMGVALGGGLGRYQGLYGLVSDNFVNLNVVLADGSTITVNESSHD
DLFWAMRGAGHNFGIVTSVQLKIYPRQVETWHYHNYVWAQDKLEDVFEALNEFQGEGDIPPLMGANFGQFSIEPS
ISQTEAVITWTFAYAGPADEAEALLEPFNAIEAISSSSGDVSYPQLLVAQGTNFESSSCSSNPYIGGTANLQTYN
VTAQRQIYHVLNERIALHPELAAGARVFYEGYASKATQEIDPDSTAYPHRDEYLVVFFASVVPQGQEGIVRELTR
EVRDLWNDGQPDRLPTTYVNHAAGGESLESMYGYEPWRLERLRGLKAKYDPKNRFRFYNPIMTD
Coding >Ophio5|4412
ATGAATCGCATAGCTCAAACGGCGGCCCTTTGGCTTGCTCTTGTTGGAACATTGGTTGCCGGCAGCCCTCTGCAT
GCTTCCAAATTCCCTCGTTATTTTCAGCGTTCCCCATTCACACGTCGAGACCTCTCAATCGTTCAAGTACAATAC
GAGTTGGGAGCAGTGTTATCGAACGGAACGGCCATTTTTGGTCCCCGAAGCTCGGCATGGGGCAATGCTACGGAA
AGATGGAACACCTTTGCCATGCCTCACATTGAGATTGTGATAGAGGTCAAAACAGAAGCAGACGTCTCGAAAGTC
GTCAAGTATTGCAATGACAACAGCATCGAATTTTTGGCCTACAGCAGGGGGCACGGTTTTACGTCTACGTTGACC
AAGTTTAGGGGTATAGAGATCAACTTGTCACAACTGACTGCCATCACGATTCAGCCCGATGGCGAGTCTGCTTGG
TTCCAGGGCGGAACATACGGAAAGATGATAATAGAGACACTCTGGGACCGCGGCTACGTTACAACTACTGGAAGC
AGTGGATGTGTGGGCCTCATGGGAGTCGCCCTGGGCGGAGGCCTTGGGCGCTATCAGGGCCTTTATGGCTTGGTG
AGCGACAATTTCGTCAACTTGAATGTCGTGCTCGCCGACGGATCGACAATCACGGTCAATGAATCAAGCCATGAC
GATCTCTTCTGGGCCATGAGGGGTGCCGGCCACAACTTTGGGATCGTGACCAGCGTACAACTCAAGATTTATCCA
CGCCAAGTGGAGACTTGGCATTATCACAACTATGTCTGGGCACAGGACAAGCTCGAGGACGTTTTCGAGGCCTTG
AACGAGTTCCAGGGCGAAGGGGATATTCCTCCCCTGATGGGTGCCAACTTCGGCCAGTTCTCGATAGAGCCGTCC
ATTAGCCAGACTGAGGCCGTGATTACTTGGACTTTTGCCTACGCGGGTCCTGCAGATGAGGCGGAAGCTCTTTTG
GAGCCTTTCAACGCCATTGAGGCAATCTCGAGCAGCAGCGGAGACGTGTCCTATCCACAGCTTCTGGTTGCTCAA
GGGACCAACTTTGAAAGCTCGTCTTGTTCCTCGAATCCATACATCGGAGGCACTGCTAACCTCCAGACCTACAAC
GTGACGGCTCAGCGCCAAATCTACCATGTTTTGAACGAGAGAATAGCTTTGCATCCCGAGCTTGCGGCTGGGGCT
CGAGTCTTCTATGAGGGCTACGCCAGCAAGGCGACTCAGGAGATCGATCCGGACTCGACGGCTTATCCTCATCGC
GATGAATATCTTGTTGTTTTCTTTGCCTCTGTCGTGCCCCAGGGACAGGAGGGCATTGTCCGGGAGTTGACGAGG
GAGGTTCGAGATCTTTGGAATGACGGTCAACCAGACCGTCTTCCGACGACGTACGTCAACCACGCCGCTGGCGGC
GAATCCCTCGAGTCTATGTATGGCTACGAGCCATGGCGTCTGGAGCGACTGCGGGGCCTCAAGGCCAAATACGAT
CCCAAGAACCGATTCCGGTTTTATAATCCAATCATGACGGAC
Transcript >Ophio5|4412
ATGAATCGCATAGCTCAAACGGCGGCCCTTTGGCTTGCTCTTGTTGGAACATTGGTTGCCGGCAGCCCTCTGCAT
GCTTCCAAATTCCCTCGTTATTTTCAGCGTTCCCCATTCACACGTCGAGACCTCTCAATCGTTCAAGTACAATAC
GAGTTGGGAGCAGTGTTATCGAACGGAACGGCCATTTTTGGTCCCCGAAGCTCGGCATGGGGCAATGCTACGGAA
AGATGGAACACCTTTGCCATGCCTCACATTGAGATTGTGATAGAGGTCAAAACAGAAGCAGACGTCTCGAAAGTC
GTCAAGTATTGCAATGACAACAGCATCGAATTTTTGGCCTACAGCAGGGGGCACGGTTTTACGTCTACGTTGACC
AAGTTTAGGGGTATAGAGATCAACTTGTCACAACTGACTGCCATCACGATTCAGCCCGATGGCGAGTCTGCTTGG
TTCCAGGGCGGAACATACGGAAAGATGATAATAGAGACACTCTGGGACCGCGGCTACGTTACAACTACTGGAAGC
AGTGGATGTGTGGGCCTCATGGGAGTCGCCCTGGGCGGAGGCCTTGGGCGCTATCAGGGCCTTTATGGCTTGGTG
AGCGACAATTTCGTCAACTTGAATGTCGTGCTCGCCGACGGATCGACAATCACGGTCAATGAATCAAGCCATGAC
GATCTCTTCTGGGCCATGAGGGGTGCCGGCCACAACTTTGGGATCGTGACCAGCGTACAACTCAAGATTTATCCA
CGCCAAGTGGAGACTTGGCATTATCACAACTATGTCTGGGCACAGGACAAGCTCGAGGACGTTTTCGAGGCCTTG
AACGAGTTCCAGGGCGAAGGGGATATTCCTCCCCTGATGGGTGCCAACTTCGGCCAGTTCTCGATAGAGCCGTCC
ATTAGCCAGACTGAGGCCGTGATTACTTGGACTTTTGCCTACGCGGGTCCTGCAGATGAGGCGGAAGCTCTTTTG
GAGCCTTTCAACGCCATTGAGGCAATCTCGAGCAGCAGCGGAGACGTGTCCTATCCACAGCTTCTGGTTGCTCAA
GGGACCAACTTTGAAAGCTCGTCTTGTTCCTCGAATCCATACATCGGAGGCACTGCTAACCTCCAGACCTACAAC
GTGACGGCTCAGCGCCAAATCTACCATGTTTTGAACGAGAGAATAGCTTTGCATCCCGAGCTTGCGGCTGGGGCT
CGAGTCTTCTATGAGGGCTACGCCAGCAAGGCGACTCAGGAGATCGATCCGGACTCGACGGCTTATCCTCATCGC
GATGAATATCTTGTTGTTTTCTTTGCCTCTGTCGTGCCCCAGGGACAGGAGGGCATTGTCCGGGAGTTGACGAGG
GAGGTTCGAGATCTTTGGAATGACGGTCAACCAGACCGTCTTCCGACGACGTACGTCAACCACGCCGCTGGCGGC
GAATCCCTCGAGTCTATGTATGGCTACGAGCCATGGCGTCTGGAGCGACTGCGGGGCCTCAAGGCCAAATACGAT
CCCAAGAACCGATTCCGGTTTTATAATCCAATCATGACGGACTGA
Gene >Ophio5|4412
ATGAATCGCATAGCTCAAACGGCGGCCCTTTGGCTTGCTCTTGTTGGAACATTGGTTGCCGGCAGCCCTCTGCAT
GCTTCCAAATTCCCTCGTTATTTTCAGCGTTCCCCATTCACACGTCGAGACCTCTCAATCGTTCAAGTACAATAC
GAGTTGGGAGCAGTGTTATCGAACGGAACGGCCATTTTTGGTCCCCGAAGCTCGGCATGGGGCAATGCTACGGAA
AGATGGAACACCTTTGCCATGCCTCACATTGAGATTGTGATAGAGGTCAAAACAGAAGCAGACGTCTCGAAAGTC
GTATGTATCGATGCTTTTCCCGTTGATACTTGGACGGAAAACTCACACTCACGCACCATCTAGGTCAAGTATTGC
AATGACAACAGCATCGAATTTTTGGCCTACAGCAGGGGGCACGGTTTTACGTCTACGTTGACCAAGTTTAGGGGT
ATAGAGATCAACTTGTCACAACTGACTGCCATCACGATTCAGCCCGATGGCGAGTCTGCTTGGTTCCAGGGCGGA
ACATACGGAAAGATGATAATAGAGACACTCTGGGACCGCGGCTACGTTACAAGTAAGTCTATTGATTCACTCGGT
TCCTTCACGACTTGAGATGAGCCCCCACTGACAGATATTCTCTCACTGCAGCTACTGGAAGCAGTGGATGTGTGG
GCCTCATGGGAGTCGCCCTGGGCGGAGGCCTTGGGCGCTATCAGGGCCTTTATGGCTTGGTGAGCGACAATTTCG
TCAACTTGAATGTCGTGCTCGCCGACGGATCGACAATCACGGTCAATGAATCAAGCCATGACGATCTCTTCTGGG
CCATGAGGGGTGCCGGCCACAACTTTGGGATCGTGACCAGCGTACAACTCAAGATTTATCCACGCCAAGTGGAGA
CTTGGCATTATCACAACTATGTCTGGGCACAGGACAAGCTCGAGGACGTTTTCGAGGCCTTGAACGAGTTCCAGG
GCGAAGGGGATATTCCTCCCCTGATGGGTGCCAACTTCGGCCAGTTCTCGATAGAGCCGTCCATTAGCCAGACTG
AGGTACGCTTCCCAAAGCCTTGGACAAAAGAAAAACTGCTGACTGACAGCATGTAGGCCGTGATTACTTGGACTT
TTGCCTACGCGGGTCCTGCAGATGAGGCGGAAGCTCTTTTGGAGCCTTTCAACGCCATTGAGGCAATCTCGAGCA
GCAGCGGAGACGTGTCCTATCCACAGCTTCTGGTTGCTCAAGGGACCAACTTTGAAAGCTCGTCTTGTTCCTCGA
ATCCATACATCGGAGGCACTGCTAACCTCCAGACCTACAACGTGACGGCTCAGCGCCAAATCTACCATGTTTTGA
ACGAGAGAATAGCTTTGCATCCCGAGCTTGCGGCTGGGGCTCGAGTCTTCTATGAGGGCTACGCCAGCAAGGCGA
CTCAGGAGATCGATCCGGACTCGACGGCTTATCCTCATCGCGATGAATATCTTGTTGTGTGAGTACTAGAGCCTT
TCCATCGTTGTTGTTTTGCTGACTGACGGTGGCTCGTGCAGTTTCTTTGCCTCTGTCGTGCCCCAGGGACAGGAG
GGCATTGTCCGGGAGTTGACGAGGGAGGTTCGAGATCTTTGGAATGACGGTCAACCAGACCGTCTTCCGACGACG
TACGTCAACCACGCCGCTGGCGGCGAATCCCTCGAGTCTATGTATGGCTACGAGCCATGGCGTCTGGAGCGACTG
CGGGGCCTCAAGGCCAAATACGATCCCAAGAACCGATTCCGGTTTTATAATCCAATCATGACGGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail